DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14115 and CG33262

DIOPT Version :9

Sequence 1:NP_648629.1 Gene:CG14115 / 39487 FlyBaseID:FBgn0036343 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_996071.2 Gene:CG33262 / 2768975 FlyBaseID:FBgn0053262 Length:208 Species:Drosophila melanogaster


Alignment Length:201 Identity:47/201 - (23%)
Similarity:80/201 - (39%) Gaps:36/201 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FLVFPRQG--SFGLLAAVAIPLELGPKNVYMAFNFESNYALPSNDS-YNQWIDRWDLDDHYLGVG 85
            ||:||||.  ....:|.:.||.:|..:::.:.:..::.|.||.|.: |.|               
  Fly    33 FLIFPRQAPTRHQFIAGIGIPADLEYESLTVGYVLKAEYYLPYNATVYRQ--------------- 82

  Fly    86 GNVTPINARQDGGDFSQDEDNEV---RRRSVGSPPPFRRHDFYRSIINFLTHYGFNGSACLLRTI 147
               .|:        |.:.:.|.:   .:|.:...|...|...|:.|.:.|..||.||.||||..|
  Fly    83 ---NPL--------FPEYKPNTIDAQDQRKLFMKPTDLRWQLYQFIEHMLNGYGLNGHACLLEAI 136

  Fly   148 CEVSESPLDDQNGLLGSLFQILFMPTTSAAEQELQHVDELYKASDAGTHGPGCSEYVAHCGHSAL 212
            ||.:...........|.:..:|..|:::...:..:.:|.:....|....  .||:|  .|....:
  Fly   137 CEANNIKFAKDFSTAGEMLHLLLSPSSTLNSESNRALDFILAEKDGSRR--DCSKY--DCNTKII 197

  Fly   213 DLISIV 218
            :..|.|
  Fly   198 NWFSFV 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14115NP_648629.1 DM4_12 116..214 CDD:214785 25/97 (26%)
CG33262NP_996071.2 DM4_12 110..192 CDD:285126 23/85 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2D2P6
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.