DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14115 and CG42811

DIOPT Version :9

Sequence 1:NP_648629.1 Gene:CG14115 / 39487 FlyBaseID:FBgn0036343 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001189279.1 Gene:CG42811 / 10178941 FlyBaseID:FBgn0261993 Length:213 Species:Drosophila melanogaster


Alignment Length:237 Identity:60/237 - (25%)
Similarity:97/237 - (40%) Gaps:52/237 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YLGGVFVLG--LS--------LAHCFLVFPRQGSFGLLAAVAIPLELGPKNVYMAFNFESNYALP 63
            |:.||..:|  ||        ||...|:||....:.:.:::::|:.:..:.::..:..:.|||||
  Fly     2 YITGVHFMGALLSLWSILRPILAELPLLFPASSVYQITSSLSVPVVIPDRKLFWDWGLQMNYALP 66

  Fly    64 SNDS----YNQWIDR---------WDLDDHYLGVGGNVTPINARQDGGDFSQDEDNEVRRRSVGS 115
            :..|    ...|.|.         |:....||..|                         .|...
  Fly    67 AEPSSFYAATIWPDEFSRRRKRQLWNETAKYLPEG-------------------------VSTMH 106

  Fly   116 PPPFRRHDFYRSIINFLTHYGFNGSACLLRTICEVSESPLDD-QNGLLGSLFQILFMPTTSAAEQ 179
            |..|...:.|.|:.|.|..|||:.| ||||::||::..|..| :|.:|.:|......|:...|..
  Fly   107 PSDFTAGELYESLENMLIQYGFDES-CLLRSVCELARHPFKDVENNMLTALLTFTLTPSLHEAFA 170

  Fly   180 ELQHV-DELYK-ASDAGTHGPGCSEYVAHCGHSALDLISIVL 219
            ..::| .|:|: |...|..|..|....::|....|..||.:|
  Fly   171 PGENVYREVYEHAEQQGFLGMDCGHLYSNCPVDFLSGISSLL 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14115NP_648629.1 DM4_12 116..214 CDD:214785 32/100 (32%)
CG42811NP_001189279.1 DM4_12 107..206 CDD:214785 31/99 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452541
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.