DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx13 and STX16

DIOPT Version :9

Sequence 1:NP_001261794.1 Gene:Syx13 / 39485 FlyBaseID:FBgn0036341 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001001433.1 Gene:STX16 / 8675 HGNCID:11431 Length:325 Species:Homo sapiens


Alignment Length:279 Identity:66/279 - (23%)
Similarity:121/279 - (43%) Gaps:58/279 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PEVSFAAAGGSSGFSPTEFMSLSEDIGHNITAIHSSTKQL----EKQLKLIGTSKEQPNL---RE 86
            ||    ||.|.:...|.:::...::|.:::..|....|:|    :|.|       .:|.|   .|
Human    64 PE----AAIGVTKRPPPKWVDGVDEIQYDVGRIKQKMKELASLHDKHL-------NRPTLDDSSE 117

  Fly    87 KVHTINTKCNARVQTTSQDLQRLQAVVRHGDRQQKLQLEKLTREFHGVVEKYSNLQRRISSA--- 148
            :.|.|    ....|..:|...|.|..|:....:.:...|:..|....||...:...:.:|::   
Human   118 EEHAI----EITTQEITQLFHRCQRAVQALPSRARACSEQEGRLLGNVVASLAQALQELSTSFRH 178

  Fly   149 --------MRQTLQQAQQFADQVVE---------------TNARAELLQQQRLEQAHLQQEHDML 190
                    |:...:::|.|.|..|.               |..:..|::|..|          |:
Human   179 AQSGYLKRMKNREERSQHFFDTSVPLMDDGDDNTLYHRGFTEDQLVLVEQNTL----------MV 233

  Fly   191 DDRRRQVEQIESDIIDVNQIMTQLSGLVHDQGQQMDFIENSIEQTAANVEDGTSELAKAARSRQS 255
            ::|.|::.||...|.|:|:|...|..::.:||..:|.|:.::||:....|||..:|.||.:.::.
Human   234 EEREREIRQIVQSISDLNEIFRDLGAMIVEQGTVLDRIDYNVEQSCIKTEDGLKQLHKAEQYQKK 298

  Fly   256 YRRKILILLVIAVIIGLIV 274
            .|:.::||::..:||.|||
Human   299 NRKMLVILILFVIIIVLIV 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx13NP_001261794.1 Syntaxin_2 54..153 CDD:291208 22/116 (19%)
SNARE_syntaxin7_like 190..249 CDD:277200 19/58 (33%)
STX16NP_001001433.1 COG5325 75..301 CDD:227635 53/246 (22%)
SNARE_syntaxin16 233..291 CDD:277198 19/57 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.