DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx13 and VAM3

DIOPT Version :9

Sequence 1:NP_001261794.1 Gene:Syx13 / 39485 FlyBaseID:FBgn0036341 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_014749.1 Gene:VAM3 / 854273 SGDID:S000005632 Length:283 Species:Saccharomyces cerevisiae


Alignment Length:288 Identity:58/288 - (20%)
Similarity:131/288 - (45%) Gaps:58/288 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EVSFAAAGGSSGFSPTEFMS--LSEDIGHNITAIHSSTKQLEKQLKLIGTSKEQPNLREKVHT-I 91
            ::...::.|:|...| :|.:  .::::.:.|......::.|||:...||:.::...||.|:.| :
Yeast     5 DIEAQSSKGNSQQEP-QFSTNQKTKELSNLIETFAEQSRVLEKECTKIGSKRDSKELRYKIETEL 68

  Fly    92 NTKCNARVQTTSQDLQRLQA-VVRHGDRQQKLQLEKLTREFHGVVEKYSNLQ------------- 142
            ...|     |:.:|  :::: ::.|       |..||:.:|..:..||.:||             
Yeast    69 IPNC-----TSVRD--KIESNILIH-------QNGKLSADFKNLKTKYQSLQQSYNQRKSLFPLK 119

  Fly   143 ----------RRISSAMRQTLQQAQQFADQVVETNARAELLQQQRLEQAHLQQEHDM-------- 189
                      |:......:.::|..:.:...::.|.::.||..:...|..||:|.:.        
Yeast   120 TPISPGTSKERKDIHPRTEAVRQDPESSYISIKVNEQSPLLHNEGQHQLQLQEEQEQQQQGLSQE 184

  Fly   190 -LD-------DRRRQVEQIESDIIDVNQIMTQLSGLVHDQGQQMDFIENSIEQTAANVEDGTSEL 246
             ||       :|.:|:.:|.:.:.:||.|..||..||.:||:|:..|:.:|.....|:::...:|
Yeast   185 ELDFQTIIHQERSQQIGRIHTAVQEVNAIFHQLGSLVKEQGEQVTTIDENISHLHDNMQNANKQL 249

  Fly   247 AKAARSRQSYRRKILILLVIAVIIGLIV 274
            .:|.:.::...:...:.|:|.:::.::|
Yeast   250 TRADQHQRDRNKCGKVTLIIIIVVCMVV 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx13NP_001261794.1 Syntaxin_2 54..153 CDD:291208 23/123 (19%)
SNARE_syntaxin7_like 190..249 CDD:277200 19/65 (29%)
VAM3NP_014749.1 COG5325 1..267 CDD:227635 55/276 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53539
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.