DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx13 and TLG2

DIOPT Version :9

Sequence 1:NP_001261794.1 Gene:Syx13 / 39485 FlyBaseID:FBgn0036341 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_014624.1 Gene:TLG2 / 854142 SGDID:S000005378 Length:397 Species:Saccharomyces cerevisiae


Alignment Length:272 Identity:58/272 - (21%)
Similarity:116/272 - (42%) Gaps:59/272 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PTEFMSLSEDIGHNITAIHSSTKQLEKQLKLIGTSKEQPNLREKVH-------------TINTKC 95
            |..|:.:::|:...:..:    ::|.:||..:......|...:|.|             .:..||
Yeast    69 PPIFIDIAQDVDDYLLEV----RRLSEQLAKVYRKNSLPGFEDKSHDEALIEDLSFKVIQMLQKC 129

  Fly    96 NA---RVQT-------TSQDLQRLQAVVRHGDRQQKLQLEKLTREFHGVVEKYSNLQR------- 143
            .|   |::|       ..:.|.|.:.::.  |..||:..||:..|.:    |:..||.       
Yeast   130 YAVMKRLKTIYNSQFVDGKQLSREELIIL--DNLQKIYAEKIQTESN----KFRVLQNNYLKFLN 188

  Fly   144 -------RISSAMRQTL-------QQAQQFADQV-VETNARAELLQQQRLEQAHLQQEHDMLDDR 193
                   |..::...||       :.|::..:.: :|..::..|   ||.:|.|.......|.:|
Yeast   189 KDDLKPIRNKASAENTLLLDDEEEEAAREKREGLDIEDYSKRTL---QRQQQLHDTSAEAYLRER 250

  Fly   194 RRQVEQIESDIIDVNQIMTQLSGLVHDQGQQMDFIENSIEQTAANVEDGTSELAKAAR-SRQSYR 257
            ..::.|:...:::|:.|..::..||.|||..:|.|:.::|.|...::....||.||.. .:::.:
Yeast   251 DEEITQLARGVLEVSTIFREMQDLVVDQGTIVDRIDYNLENTVVELKSADKELNKATHYQKRTQK 315

  Fly   258 RKILILLVIAVI 269
            .|:::||.:.||
Yeast   316 CKVILLLTLCVI 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx13NP_001261794.1 Syntaxin_2 54..153 CDD:291208 23/135 (17%)
SNARE_syntaxin7_like 190..249 CDD:277200 16/58 (28%)
TLG2NP_014624.1 COG5325 35..338 CDD:227635 58/272 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.