DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx13 and STX7

DIOPT Version :9

Sequence 1:NP_001261794.1 Gene:Syx13 / 39485 FlyBaseID:FBgn0036341 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001313507.1 Gene:STX7 / 8417 HGNCID:11442 Length:261 Species:Homo sapiens


Alignment Length:257 Identity:61/257 - (23%)
Similarity:129/257 - (50%) Gaps:18/257 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GFSPTEFMSLSEDIGHNITAIHSSTKQLEKQLKLIGTSKEQPNLREKVHTINTKCNARVQTTSQD 105
            |..|.:   |::.|..||..|...:.::::.|..:||.::.|.||:::.......|...:.|.:.
Human     8 GGDPAQ---LAQRISSNIQKITQCSVEIQRTLNQLGTPQDSPELRQQLQQKQQYTNQLAKETDKY 69

  Fly   106 LQRLQAV--VRHGDRQQKLQLEKLTREFHGVVEKYSNLQRRISSAMRQ---TLQQAQQFADQVVE 165
            ::...::  .....||:|:|.::|..||...:..:..:||:.:...::   .::.:.:.:....|
Human    70 IKEFGSLPTTPSEQRQRKIQKDRLVAEFTTSLTNFQKVQRQAAEREKEFVARVRASSRVSGSFPE 134

  Fly   166 TNARAELL---QQQRLEQAHLQQEHDMLDD------RRRQVEQIESDIIDVNQIMTQLSGLVHDQ 221
            .:::...|   :.|...|..:|.|....||      |...:.|:|:||:|:|:|...|..::|:|
Human   135 DSSKERNLVSWESQTQPQVQVQDEEITEDDLRLIHERESSIRQLEADIMDINEIFKDLGMMIHEQ 199

  Fly   222 GQQMDFIENSIEQTAANVEDGTSELAKAARSRQSYRRKILILLVIAVIIGLIVTGVIVAKLN 283
            |..:|.||.::|....:|:....:|::|| ..|...||.|.::::.::||:.:..:|:..||
Human   200 GDVIDSIEANVENAEVHVQQANQQLSRAA-DYQRKSRKTLCIIILILVIGVAIISLIIWGLN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx13NP_001261794.1 Syntaxin_2 54..153 CDD:291208 21/103 (20%)
SNARE_syntaxin7_like 190..249 CDD:277200 20/64 (31%)
STX7NP_001313507.1 Syntaxin_2 18..119 CDD:373109 21/100 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..148 2/18 (11%)
SNARE_syntaxin7 168..227 CDD:277228 18/58 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53539
OrthoDB 1 1.010 - - D1204812at2759
OrthoFinder 1 1.000 - - FOG0000747
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.