DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx13 and SYP21

DIOPT Version :9

Sequence 1:NP_001261794.1 Gene:Syx13 / 39485 FlyBaseID:FBgn0036341 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_197185.1 Gene:SYP21 / 831546 AraportID:AT5G16830 Length:279 Species:Arabidopsis thaliana


Alignment Length:248 Identity:63/248 - (25%)
Similarity:120/248 - (48%) Gaps:21/248 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 SEDIGHNITAIHSSTKQLEKQLKLIGTSKEQPNLREKVHTINTKCNARVQTTSQDLQRLQAVVRH 115
            |:::...|..|.::.....:.:..|||.|:...||:|:.....:.:..|:.||..|:.......|
plant    33 SQEVAAGIFRISTAVNSFFRLVNSIGTPKDTLELRDKLQKTRLQISELVKNTSAKLKEASEADLH 97

  Fly   116 GDRQQ--KLQLEKLTREFHGVVEKYSNLQRRISSAMRQ------------TLQQAQQFADQVVE- 165
            |...|  |:...||.::|..|::::...||  .:|.|:            |...|.:...:.:. 
plant    98 GSASQIKKIADAKLAKDFQSVLKEFQKAQR--LAAEREITYTPVVTKEIPTSYNAPELDTESLRI 160

  Fly   166 TNARAELLQQQRLEQAHLQQE----HDMLDDRRRQVEQIESDIIDVNQIMTQLSGLVHDQGQQMD 226
            :..:|.|||.:|.|...|..|    ..::::|.:.:.:||..|.|||.:...|:.:|:.||..:|
plant   161 SQQQALLLQSRRQEVVFLDNEITFNEAIIEEREQGIREIEDQIRDVNGMFKDLALMVNHQGNIVD 225

  Fly   227 FIENSIEQTAANVEDGTSELAKAARSRQSYRRKILILLVIAVIIGLIVTGVIV 279
            .|.::::.:.|.....|.:|.|||::::|......:|::|..|:.|||..|::
plant   226 DISSNLDNSHAATTQATVQLRKAAKTQRSNSSLTCLLILIFGIVLLIVIIVVL 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx13NP_001261794.1 Syntaxin_2 54..153 CDD:291208 25/112 (22%)
SNARE_syntaxin7_like 190..249 CDD:277200 16/58 (28%)
SYP21NP_197185.1 SynN 27..164 CDD:238105 28/132 (21%)
SNARE_Qa 189..247 CDD:277193 16/57 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53539
OrthoDB 1 1.010 - - D1204812at2759
OrthoFinder 1 1.000 - - FOG0000747
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19957
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.890

Return to query results.
Submit another query.