DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx13 and SYP23

DIOPT Version :9

Sequence 1:NP_001261794.1 Gene:Syx13 / 39485 FlyBaseID:FBgn0036341 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001078403.1 Gene:SYP23 / 827494 AraportID:AT4G17730 Length:262 Species:Arabidopsis thaliana


Alignment Length:249 Identity:63/249 - (25%)
Similarity:116/249 - (46%) Gaps:32/249 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GGSSGFSPTEFMSLSEDIGHNITAIHSSTKQLEKQLKLIGTSKEQPNLREKVHTINTKCNARVQT 101
            ||.|....|      :|:...|..|::|.....:.:..:||.|:.|.||||:|.........|:.
plant    22 GGGSRQDTT------QDVASGIFQINTSVSTFHRLVNTLGTPKDTPELREKLHKTRLYIGQLVKD 80

  Fly   102 TSQDLQRLQAV--VRHGDRQQKLQLEKLTREFHGVVEKYSNLQRRISSAMRQTL--------QQA 156
            ||..|:.....  .|..::::|:...||.::|..|::::...||  .:|.|:|:        ...
plant    81 TSAKLKEASETDHQRGVNQKKKIVDAKLAKDFQAVLKEFQKAQR--LAAERETVYAPLVHKPSLP 143

  Fly   157 QQFADQVVETNA------RAELLQQQRLEQAHLQQE----HDMLDDRRRQVEQIESDIIDVNQIM 211
            ..:....::.|.      ||.|::.:|.|...|..|    ..::::|.:.:::|:..|.:|::|.
plant   144 SSYTSSEIDVNGDKHPEQRALLVESKRQELVLLDNEIAFNEAVIEEREQGIQEIQQQIGEVHEIF 208

  Fly   212 TQLSGLVHDQGQQMDFIENSIEQTAANVEDGTSELAKAARSRQSYRRKILILLV 265
            ..|:.||||||..:|.|...|:.:.|....|.|.|.:    .|.::.:||:.|:
plant   209 KDLAVLVHDQGNMIDDIGTHIDNSYAATAQGKSHLVR----HQRHKDQILLCLI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx13NP_001261794.1 Syntaxin_2 54..153 CDD:291208 26/100 (26%)
SNARE_syntaxin7_like 190..249 CDD:277200 19/58 (33%)
SYP23NP_001078403.1 Syntaxin_2 33..133 CDD:291208 27/101 (27%)
SNARE_Qa <204..245 CDD:277193 16/40 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53539
OrthoDB 1 1.010 - - D1204812at2759
OrthoFinder 1 1.000 - - FOG0000747
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19957
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.890

Return to query results.
Submit another query.