DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx13 and Stx17

DIOPT Version :9

Sequence 1:NP_001261794.1 Gene:Syx13 / 39485 FlyBaseID:FBgn0036341 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_080619.2 Gene:Stx17 / 67727 MGIID:1914977 Length:301 Species:Mus musculus


Alignment Length:243 Identity:61/243 - (25%)
Similarity:107/243 - (44%) Gaps:36/243 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 AIHSSTK-----QLEKQLK-LIGTSKEQP-NLREKVHTINTKCNARVQTTSQDLQRLQAVVRHGD 117
            ||...||     .||:..| .|...|.|. .:.:|:|..:......||....:::.::.:.....
Mouse    16 AIQKFTKIVIPTDLERLRKHQINIEKYQRCRIWDKLHEEHINAGRTVQQLRSNIREMEKLCLKVH 80

  Fly   118 RQQKLQLEKL-----------TREF---HGVVEKYSNLQRRISSAMRQTLQQA---QQFADQVVE 165
            :...:.|:::           |.||   |  :|....|:::::.  .:.||.:   ....|.|:.
Mouse    81 KDDLVLLKRMIDPVKEAAATATAEFLQLH--LESVEELKKQVND--EELLQPSLTRSTTVDGVLH 141

  Fly   166 TNARAELLQQQRLEQAHLQQEHDMLDDRRRQVEQIESDIIDVNQIMTQLSGLVHDQGQQMDFIEN 230
            | ..||...|. |.|.:...|.....:.....|.:|:|:|:::.::|.:|.||..|.:::|.|.:
Mouse   142 T-GEAEAASQS-LTQIYALPEIPQDQNAAESWETLEADLIELSHLVTDMSLLVSSQQEKIDSIAD 204

  Fly   231 SIEQTAANVEDGTSELAKAARSRQSYRRKILILLVIAVIIGLIVTGVI 278
            .:...|.|||:||..|.|||      :.|:..|.|...:||.:|.|.|
Mouse   205 HVNSAAVNVEEGTKNLQKAA------KYKLAALPVAGALIGGVVGGPI 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx13NP_001261794.1 Syntaxin_2 54..153 CDD:291208 21/113 (19%)
SNARE_syntaxin7_like 190..249 CDD:277200 18/58 (31%)
Stx17NP_080619.2 SNARE_syntaxin17 161..222 CDD:277199 18/60 (30%)
Necessary and sufficient for localization to autophagosome. /evidence=ECO:0000250|UniProtKB:P56962 228..274 7/19 (37%)
Endoplasmic reticulum retention signal. /evidence=ECO:0000255 298..301
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.