DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx13 and stx12l

DIOPT Version :9

Sequence 1:NP_001261794.1 Gene:Syx13 / 39485 FlyBaseID:FBgn0036341 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_697581.4 Gene:stx12l / 569124 ZFINID:ZDB-GENE-110715-1 Length:267 Species:Danio rerio


Alignment Length:273 Identity:76/273 - (27%)
Similarity:140/273 - (51%) Gaps:32/273 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 YGAMADSTPEVSFAAAGGSSGFSPTEFMSLSEDIGHNITAIHSSTKQLEKQLKLIGTSKEQPNLR 85
            || |.||:...|          .|.:|.:|::....||..|..:|.|::..|..:||..:.|.|:
Zfish     3 YG-MMDSSHSQS----------QPRDFNNLTQTCSSNIQKITQNTGQIKSMLFQLGTRPDTPELQ 56

  Fly    86 EKVHTINTKCNARVQTTSQDLQRL----QAVVRHGDRQQKLQLEKLTREFHGVVEKYSNLQRRIS 146
            :::..:....|...:.|::.|:.|    |.......|||::|.::|..:|...:..:..:|||.:
Zfish    57 DRLQQVQHYTNQLAKETNRHLKDLGTLPQPQSPSEQRQQRIQKDRLMNDFSAALNNFQVVQRRAA 121

  Fly   147 SAMRQTLQQAQ---QFADQVVETNARAELLQQQRLEQAHLQQEH--------DMLDDRRRQVEQI 200
            ...|:::.:|:   :|  ||.|.|...:|:..::.|...:|.|.        :::.:|...:.|:
Zfish   122 ERERESVARARAGSRF--QVDELNQDEQLVTFEKNEGWRMQTEEEPVTEEDLELIKERETNIRQL 184

  Fly   201 ESDIIDVNQIMTQLSGLVHDQGQQMDFIENSIEQTAANVEDGTSELAKAARSRQSYRRKI----L 261
            ||||:|||||...|:.::||||..:|.||.::|....:||.|..:|..||..::..|:::    |
Zfish   185 ESDIMDVNQIFKDLAVMIHDQGDMIDSIEANVESAEVHVERGAEQLQHAAYYQRKSRKRMCILAL 249

  Fly   262 ILLVIAVIIGLIV 274
            :|.::|.|..:|:
Zfish   250 VLSLVATIFAIII 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx13NP_001261794.1 Syntaxin_2 54..153 CDD:291208 25/102 (25%)
SNARE_syntaxin7_like 190..249 CDD:277200 24/58 (41%)
stx12lXP_697581.4 Syntaxin_2 26..128 CDD:291208 25/101 (25%)
Syntaxin 29..206 CDD:279182 48/178 (27%)
SNARE_syntaxin12 174..240 CDD:277229 26/65 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I11993
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53539
OrthoDB 1 1.010 - - D1204812at2759
OrthoFinder 1 1.000 - - FOG0000747
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.