DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx13 and STX17

DIOPT Version :9

Sequence 1:NP_001261794.1 Gene:Syx13 / 39485 FlyBaseID:FBgn0036341 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_060389.2 Gene:STX17 / 55014 HGNCID:11432 Length:302 Species:Homo sapiens


Alignment Length:244 Identity:61/244 - (25%)
Similarity:104/244 - (42%) Gaps:46/244 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LEKQLKLI------GTSKEQPNLR--------EKVHTINTKCNARVQ---TTSQDLQRLQAVVRH 115
            ::|.:|::      ...|.|.|:.        :|:|..:......||   :..:::::|...||.
Human    17 IQKFIKIVIPTDLERLRKHQINIEKYQRCRIWDKLHEEHINAGRTVQQLRSNIREIEKLCLKVRK 81

  Fly   116 GD--------RQQKLQLEKLTREF---HGVVEKYSNLQRRISSAMRQTLQQAQQFADQVV----- 164
            .|        ...|.:....|.||   |  :|....|:::.:.  .:||.|........|     
Human    82 DDLVLLKRMIDPVKEEASAATAEFLQLH--LESVEELKKQFND--EETLLQPPLTRSMTVGGAFH 142

  Fly   165 ETNARAELLQQQRLEQAHLQQEHDMLDDRRRQVEQIESDIIDVNQIMTQLSGLVHDQGQQMDFIE 229
            .|.|.|   ..|.|.|.:...|.....:.....|.:|:|:|:::|::|..|.||:.|.:::|.|.
Human   143 TTEAEA---SSQSLTQIYALPEIPQDQNAAESWETLEADLIELSQLVTDFSLLVNSQQEKIDSIA 204

  Fly   230 NSIEQTAANVEDGTSELAKAARSRQSYRRKILILLVIAVIIGLIVTGVI 278
            :.:...|.|||:||..|.|||      :.|:..|.|...:||.:|.|.|
Human   205 DHVNSAAVNVEEGTKNLGKAA------KYKLAALPVAGALIGGMVGGPI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx13NP_001261794.1 Syntaxin_2 54..153 CDD:291208 20/112 (18%)
SNARE_syntaxin7_like 190..249 CDD:277200 19/58 (33%)
STX17NP_060389.2 COG5325 2..228 CDD:227635 53/223 (24%)
SNARE_syntaxin17 162..223 CDD:277199 19/60 (32%)
Necessary and sufficient for localization to autophagosome. /evidence=ECO:0000269|PubMed:23217709 229..275 7/19 (37%)
Endoplasmic reticulum retention signal. /evidence=ECO:0000255 299..302
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.