DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx13 and stx17

DIOPT Version :9

Sequence 1:NP_001261794.1 Gene:Syx13 / 39485 FlyBaseID:FBgn0036341 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_005158110.1 Gene:stx17 / 492808 ZFINID:ZDB-GENE-041114-164 Length:292 Species:Danio rerio


Alignment Length:253 Identity:58/253 - (22%)
Similarity:108/253 - (42%) Gaps:63/253 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PTEFMSLSEDIGHNITAIHSSTKQLEKQLKLIGTSKEQPNLR-EKVHTINTKCNARVQTTSQDLQ 107
            ||:...|.:. .|||                   .|.|.|.: :|:|..:...:..||....:|:
Zfish    27 PTDLERLHQH-QHNI-------------------EKFQRNRQWDKLHHEHINSSRTVQQLRSNLR 71

  Fly   108 RLQAV---VRHGDRQQKLQLEKLTREFHGVVEKYSNLQRRISSAMRQTLQ------QAQQFADQV 163
            .::.:   ||..|.:   .||||.:.          ::.|.|:|:::.||      ..|.|.:.:
Zfish    72 EMEKLCGRVRSVDAE---ALEKLVQP----------IRDRASAAIQEFLQIHSDAVNRQNFNEAI 123

  Fly   164 V----------ETNARAELLQQQRLEQAHLQQEHDMLDDRRRQVEQIESDIIDVNQIMTQLSGLV 218
            .          :|......:.|.:|....:..|.:..:    ..:.:..|::.:|.::.:.|.:|
Zfish   124 ATVAETSHSEDDTGVSGSPVTQTQLLLPEIPSEQNAAE----SWDSLAEDLLQLNGLVNEFSTIV 184

  Fly   219 HDQGQQMDFIENSIEQTAANVEDGTSELAKAARSRQSYRRKILILLVIAVIIGLIVTG 276
            |.|.:::|.||.::...|||||:||..|.||||:      |:.:|.|...::|.::.|
Zfish   185 HAQQEKIDSIEANVSIAAANVEEGTQSLGKAARA------KLAVLPVAGAVVGGVLGG 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx13NP_001261794.1 Syntaxin_2 54..153 CDD:291208 21/102 (21%)
SNARE_syntaxin7_like 190..249 CDD:277200 17/58 (29%)
stx17XP_005158110.1 SNARE_syntaxin17 153..214 CDD:277199 18/64 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.