DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx13 and stx12

DIOPT Version :9

Sequence 1:NP_001261794.1 Gene:Syx13 / 39485 FlyBaseID:FBgn0036341 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_009292402.1 Gene:stx12 / 415141 ZFINID:ZDB-GENE-040625-11 Length:267 Species:Danio rerio


Alignment Length:258 Identity:73/258 - (28%)
Similarity:136/258 - (52%) Gaps:17/258 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SPTEFMSLSEDIGHNITAIHSSTKQLEKQLKLIGTSKEQPNLREKVHTINTKCNARVQTTSQDLQ 107
            ||.:|.||.:....||..|..:|.|::..:..:||..:...|||::..:....|...:.|::.|:
Zfish    11 SPKDFSSLIQTCSSNIQKITLNTAQIKGLVNQLGTKLDTSGLRERLQYMQHHTNQLAKETNKHLK 75

  Fly   108 RLQA----VVRHGDRQQKLQLEKLTREFHGVVEKYSNLQRRISSAMRQTLQQAQQFADQVVETNA 168
            .|.:    |.....||||:|.::|..:|...:..:..:||:.:...::::.:|:..:....:...
Zfish    76 DLGSISLPVSLSEQRQQKIQKDRLMNDFSAALNNFQAVQRQAAEKEKESVARARAGSRLSADDGG 140

  Fly   169 RAELL------------QQQRLEQAHLQQEHDMLDDRRRQVEQIESDIIDVNQIMTQLSGLVHDQ 221
            ..|.|            ..|..:.|..:::.:::.:|...:.|:||||:|||||...|:.::|||
Zfish   141 HDEQLVSFDNNDDWGKTTTQTEDVAITEEDLELIKERETAIRQLESDILDVNQIFKDLAVMIHDQ 205

  Fly   222 GQQMDFIENSIEQTAANVEDGTSELAKAARSRQSYRRKILILLVIAVIIGLIVTGVIVAKLNS 284
            |:.:|.||.::|....:||.|..:|.:||:.:|..|:||..|.|...|:.||: |:::.||:|
Zfish   206 GEMIDSIEANVESAEVHVERGAEQLQRAAQYQQKSRKKICFLAVGLSIVVLII-GIVIWKLSS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx13NP_001261794.1 Syntaxin_2 54..153 CDD:291208 24/102 (24%)
SNARE_syntaxin7_like 190..249 CDD:277200 24/58 (41%)
stx12XP_009292402.1 Syntaxin_2 23..125 CDD:291208 24/101 (24%)
SNARE_syntaxin12 174..240 CDD:277229 27/65 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I11993
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53539
OrthoDB 1 1.010 - - D1204812at2759
OrthoFinder 1 1.000 - - FOG0000747
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.