DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx13 and stx12

DIOPT Version :9

Sequence 1:NP_001261794.1 Gene:Syx13 / 39485 FlyBaseID:FBgn0036341 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_998883.1 Gene:stx12 / 407856 XenbaseID:XB-GENE-974475 Length:267 Species:Xenopus tropicalis


Alignment Length:249 Identity:76/249 - (30%)
Similarity:139/249 - (55%) Gaps:20/249 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 EFMSLSEDIGHNITAIHSSTKQLEKQLKLIGTSKEQPNLREKVHTINTKCNARVQTTSQDLQRLQ 110
            :|.|:.:....|:..|.::|.|:...|..:|||::...|::.:..|....|...:.|:..|:.|.
 Frog    13 DFNSIIQTCSGNVQRITNNTAQIRTLLNQLGTSQDSTKLQQNLQQIQHSTNVLAKETNTYLKDLA 77

  Fly   111 AVVR----HGDRQQKLQLEKLTREFHGVVEKYSNLQRRISSAMRQTLQQA----------QQFAD 161
            :|..    ...||||||.|:|..:|...:..:..:||::|:..::|:.:|          :|..:
 Frog    78 SVPTPLSPAEQRQQKLQKERLMNDFSAALNHFQAIQRQVSTKEKETVARARAGSRLSADERQKEE 142

  Fly   162 QVV--ETNARAELLQQQRLEQAHLQQEHDMLDDRRRQVEQIESDIIDVNQIMTQLSGLVHDQGQQ 224
            |:|  :.|.....||.|..|.|..:::.:::.:|...::::|:||:|||||...|:.::||||:.
 Frog   143 QLVSFDNNEDWNQLQSQDEEFAVTEEDLELIKERESAIQKLEADILDVNQIFKDLAVMIHDQGEM 207

  Fly   225 MDFIENSIEQTAANVEDGTSELAKAARSRQSYRRKILILL----VIAVIIGLIV 274
            :|.||.::|....:||.||.:|.:||..::..|:||.||:    :.|||:|||:
 Frog   208 IDSIEANVESAEVHVERGTEQLQRAAYYQKKSRKKICILVLALAIAAVILGLII 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx13NP_001261794.1 Syntaxin_2 54..153 CDD:291208 27/102 (26%)
SNARE_syntaxin7_like 190..249 CDD:277200 23/58 (40%)
stx12NP_998883.1 Syntaxin_2 22..124 CDD:373109 27/101 (27%)
SNARE_syntaxin12 173..239 CDD:277229 25/65 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11944
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53539
OrthoDB 1 1.010 - - D1204812at2759
OrthoFinder 1 1.000 - - FOG0000747
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.