DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx13 and TSNARE1

DIOPT Version :9

Sequence 1:NP_001261794.1 Gene:Syx13 / 39485 FlyBaseID:FBgn0036341 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_011515216.1 Gene:TSNARE1 / 203062 HGNCID:26437 Length:838 Species:Homo sapiens


Alignment Length:306 Identity:78/306 - (25%)
Similarity:136/306 - (44%) Gaps:55/306 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKALNNPGGNGGGGGPHRDYGAMADSTPEVSFAA------AGGSSGFS----------PTEFMS 49
            :.||.:.|  :.|.|.|.    |:| .||.....|      |..|.|||          |.....
Human   229 LRKAAHGP--SPGSGKPQ----ALA-LTPVEQVVAKTFSCQALPSEGFSLEPPRATQVDPCNLQE 286

  Fly    50 LSEDIGHNITAIHSSTKQLEKQLKLIGTSKEQPNLREKVHTINTKCNARVQTTSQDLQRLQAVVR 114
            |.:::..|:..|:||...||:.|:.:||..:...||:.:||...:.|..:..::..::::..::|
Human   287 LFQEMSANVFRINSSVTSLERSLQSLGTPSDTQELRDSLHTAQQETNKTIAASASSVKQMAELLR 351

  Fly   115 HGDRQQKL-----QLEKLTREFHGVVEKYSNLQRRISSAMRQTLQQAQQFADQVVETNARAELLQ 174
            ....|::|     ||::|..:....::.|..:|::|:...|..|..||:.:.|.......|||..
Human   352 SSCPQERLQQERPQLDRLKTQLSDAIQCYGVVQKKIAEKSRALLPMAQRGSKQQSPQAPFAELAD 416

  Fly   175 QQRL-----------EQAHLQQ--EHDMLDDRRRQ--VEQIESDIIDVNQIMTQLSGLVHDQGQQ 224
            .:::           |||.|..  |.|:...|.|:  :.|:||:::|||||:..|:.:|.:||:.
Human   417 DEKVFNGSDNMWQGQEQALLPDITEEDLEAIRLREEAILQMESNLLDVNQIIKDLASMVSEQGEA 481

  Fly   225 MDFIEN--------SIEQTAA----NVEDGTSELAKAARSRQSYRR 258
            :....:        |.|..||    ....|::.|.....||...|:
Human   482 VGSSSSKAICQQSCSPEPAAAALLLGAGPGSTPLRPGPHSRTKTRK 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx13NP_001261794.1 Syntaxin_2 54..153 CDD:291208 24/103 (23%)
SNARE_syntaxin7_like 190..249 CDD:277200 20/72 (28%)
TSNARE1XP_011515216.1 Myb_DNA-bind_5 151..225 CDD:290584
Syntaxin_2 292..393 CDD:291208 23/100 (23%)
SNARE 444..>484 CDD:304603 14/39 (36%)
Myb_DNA-bind_5 526..598 CDD:290584 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151503
Domainoid 1 1.000 49 1.000 Domainoid score I11831
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H77339
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000747
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR19957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.840

Return to query results.
Submit another query.