DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx13 and syx-7

DIOPT Version :9

Sequence 1:NP_001261794.1 Gene:Syx13 / 39485 FlyBaseID:FBgn0036341 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_492422.2 Gene:syx-7 / 172718 WormBaseID:WBGene00009478 Length:248 Species:Caenorhabditis elegans


Alignment Length:247 Identity:70/247 - (28%)
Similarity:117/247 - (47%) Gaps:27/247 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 MSLSEDIGH--------NITAIHSSTKQLEKQLKLIGTSKEQPNLREKVHTINTKC-NAR--VQT 101
            |..:.|.|:        ||..::....|||..:..:..|.|. ..||: ...|.|. ||:  .:.
 Worm     1 MDFNRDAGNETASQLQLNIQNLNQQVIQLESFITNLSDSSES-GQRER-ELFNRKAHNAQELSKE 63

  Fly   102 TSQDLQRLQAVVRHGDRQQKLQLEKLTREFHGVVEKYSNLQRRISS-------AMRQTLQQAQQF 159
            |:..|:|| .|:.:.|:..:...|:|..|:.||:.:....||:.:.       |.....|.|:..
 Worm    64 TNALLKRL-VVMSNSDKNLRGVRERLQNEYIGVLNRLQASQRKAAQTEKAGMVAAEMDAQAARDA 127

  Fly   160 AD-QVVETNARA-ELLQQQRLEQAHLQQEHDMLDDRRRQVEQIESDIIDVNQIMTQLSGLVHDQG 222
            |: .:...|.|: ..:|....:|.:||.    :.:|:..::|:|.||.|||.|..:|:.:||:||
 Worm   128 AEYDMYGNNGRSGGQMQMTAQQQGNLQD----MKERQNALQQLERDIGDVNAIFAELANIVHEQG 188

  Fly   223 QQMDFIENSIEQTAANVEDGTSELAKAARSRQSYRRKILILLVIAVIIGLIV 274
            ..:|.||.::|.....||.|...:.:|....|..|:|.|:||...||:..|:
 Worm   189 DMVDSIEANVEHAQIYVEQGAQNVQQAVYYNQKARQKKLLLLCFFVILIFII 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx13NP_001261794.1 Syntaxin_2 54..153 CDD:291208 28/116 (24%)
SNARE_syntaxin7_like 190..249 CDD:277200 21/58 (36%)
syx-7NP_492422.2 SynN 3..111 CDD:214699 28/110 (25%)
SNARE_syntaxin7_like 156..215 CDD:277200 21/58 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53539
OrthoDB 1 1.010 - - D1204812at2759
OrthoFinder 1 1.000 - - FOG0000747
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.