DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx13 and syx-17

DIOPT Version :9

Sequence 1:NP_001261794.1 Gene:Syx13 / 39485 FlyBaseID:FBgn0036341 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_492342.1 Gene:syx-17 / 172663 WormBaseID:WBGene00012150 Length:250 Species:Caenorhabditis elegans


Alignment Length:225 Identity:53/225 - (23%)
Similarity:98/225 - (43%) Gaps:42/225 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KQLKLIGTSKEQPNLREKVHTINTKCNARVQTTSQDLQRLQAVVR---HGDRQQKLQLEKLTREF 131
            :::.|.|..::.|.||:.:        |..:...:|..|....||   |..||:        .||
 Worm    17 QRIALQGGLRDTPALRDSI--------AAYEKDLEDGLRGILTVRGELHDSRQE--------NEF 65

  Fly   132 HGVVEKYSNLQRRISSAMRQT-------------LQQAQQFADQVVETNARAELLQQQRLEQAHL 183
            ..:::.   ::::|.:.:..|             .:||.: .|...|..:| ..|::..|:...|
 Worm    66 DSIIDP---IRQQIKTLLNVTRSLPAVNLPGSNPFEQATE-DDNPYEMESR-RYLRETTLKDNEL 125

  Fly   184 QQEHDMLDDRRRQVEQIESDIIDVNQIMTQLSGLVHDQGQQMDFIENSIEQTAANVEDGTSELAK 248
            :|..|.:.:|.....:||.|:.|:.:|..:|..:||:|...:|.||..:|:...:|:.|...|.|
 Worm   126 RQLADDMKERAEATVKIEKDMADLEKIFQELGRIVHEQHDVVDSIEEQVERATEDVKRGNENLKK 190

  Fly   249 AARSRQSYRRKILILLVIAVIIGLIVTGVI 278
            |.:|:.:...     |...|:.||.|.|.:
 Worm   191 AVKSKAAKAP-----LYAGVVGGLAVGGPV 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx13NP_001261794.1 Syntaxin_2 54..153 CDD:291208 17/98 (17%)
SNARE_syntaxin7_like 190..249 CDD:277200 17/58 (29%)
syx-17NP_492342.1 SNARE 132..188 CDD:389950 16/55 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162097
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1204812at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.710

Return to query results.
Submit another query.