DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx13 and tsnare1

DIOPT Version :9

Sequence 1:NP_001261794.1 Gene:Syx13 / 39485 FlyBaseID:FBgn0036341 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_005158362.1 Gene:tsnare1 / 101882035 ZFINID:ZDB-GENE-100922-189 Length:287 Species:Danio rerio


Alignment Length:288 Identity:90/288 - (31%)
Similarity:154/288 - (53%) Gaps:33/288 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GGNGGGGGPHRD-YGAMADSTPEVSFAAAGGSSGFSPTEFMSLSEDIGHNITAIHSSTKQLEKQL 72
            |.....|||.|. |..:|...              ||:|...:.::...||..|:::...|||.|
Zfish    12 GSRNPFGGPTRQGYQPVATQV--------------SPSELQDVFQETSSNIFQINANVVTLEKNL 62

  Fly    73 KLIGTSKEQPNLREKVHTINTKCNARVQTTSQDLQRLQAVVRHGDRQQKLQLEKLTREFHGVVEK 137
            :.:|||::...||:.:|:...:.|..:.:|||.:::|..::....||.:|:|.:|..|....|::
Zfish    63 QSLGTSRDTAELRQSLHSTQQQTNKVITSTSQLVKQLTDIISGSSRQDRLRLTRLKTELSDSVQR 127

  Fly   138 YSNLQRRISSAMRQTLQQAQQFADQVVETNARAELLQQQRL----------EQAHL----QQEHD 188
            |..||::|:...|..|..||:...|.|:| ..:||:::..|          .||.|    :::.:
Zfish   128 YGELQKKIADRSRALLPPAQKDRKQSVQT-PFSELVEEGPLFGAGESTEGDVQAFLSEISEEDVE 191

  Fly   189 MLDDRRRQVEQIESDIIDVNQIMTQLSGLVHDQGQQMDFIENSIEQTAANVEDGTSELAKAAR-S 252
            :|..|...:.|||.|::||||||..|:.:||:||..:|.||:.|:.|:::||....|||||:. .
Zfish   192 ILRQREEALLQIERDMLDVNQIMKDLASMVHEQGDTIDSIEDYIQTTSSHVETANQELAKASHYQ 256

  Fly   253 RQSYRRKILILLVIAVIIGLIVTGVIVA 280
            ||..|||..:|:...:::.|::  :|:|
Zfish   257 RQLRRRKCFLLIGGLLLLTLLI--IIIA 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx13NP_001261794.1 Syntaxin_2 54..153 CDD:291208 30/98 (31%)
SNARE_syntaxin7_like 190..249 CDD:277200 27/58 (47%)
tsnare1XP_005158362.1 Syntaxin_2 44..141 CDD:291208 29/96 (30%)
SNARE_syntaxin7_like 193..252 CDD:277200 27/58 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585964
Domainoid 1 1.000 62 1.000 Domainoid score I10407
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H77339
Inparanoid 1 1.050 132 1.000 Inparanoid score I4604
OMA 1 1.010 - - QHG53539
OrthoDB 1 1.010 - - D1204812at2759
OrthoFinder 1 1.000 - - FOG0000747
OrthoInspector 1 1.000 - - oto40281
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR19957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1111.010

Return to query results.
Submit another query.