DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx13 and stx16

DIOPT Version :9

Sequence 1:NP_001261794.1 Gene:Syx13 / 39485 FlyBaseID:FBgn0036341 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_031750392.1 Gene:stx16 / 100493473 XenbaseID:XB-GENE-5943021 Length:323 Species:Xenopus tropicalis


Alignment Length:316 Identity:76/316 - (24%)
Similarity:135/316 - (42%) Gaps:66/316 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKALNNPGGNGGGGGPHRDYGAMADS----------TPEVSFAAAGGSSGFSPTEFMSLSEDIG 55
            :::.::|....|....|..:...:||.          .||    ||.|.:...|.:::...|:|.
 Frog    24 LAEQVSNERRPGSARSPGAELDELADDRMALVSGLSLDPE----AAIGVTKRLPPKWVDGVEEIQ 84

  Fly    56 HNITAIHSSTKQL----EKQLKLIGTSKEQPNL---REKVHTIN------TKCNARVQTTSQDLQ 107
            :.:|.|....|.|    :|.|       .:|.|   .|:.|.|.      |:...|.|   :.:|
 Frog    85 YEVTRIKQKMKDLASLHDKHL-------NRPTLDDSTEEEHAIEITTQEVTQMFHRCQ---RSVQ 139

  Fly   108 RLQAVVRHGDRQQKLQL----EKLTREFHGVVEKYSNLQRRISSAMRQTLQQAQQFADQVVE--- 165
            .||:..||...|::..|    ..|.:....:...:.:.|......|:...::::.|.|..|.   
 Frog   140 SLQSRCRHCTEQEERLLRNVVSSLAQSLQDLSTNFRHTQSGYLKRMKNREERSKHFFDTSVPLMD 204

  Fly   166 ------------TNARAELLQQQRLEQAHLQQEHDMLDDRRRQVEQIESDIIDVNQIMTQLSGLV 218
                        |..:..|:||..|          |:::|.|::.||...|.|:|::..:|:|:|
 Frog   205 DGEDNTLYDRGFTEDQLVLVQQNTL----------MVEERERELRQIVQSISDLNEVFRELAGMV 259

  Fly   219 HDQGQQMDFIENSIEQTAANVEDGTSELAKAARSRQSYRRKILILLVIAVIIGLIV 274
            .:||..:|.|:.::||.....|||...|.||.:.::..|:.::||::..|:|.|||
 Frog   260 VEQGTVLDRIDYNVEQACVKTEDGLKHLQKAEQYQKKNRKMLVILILFVVVIVLIV 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx13NP_001261794.1 Syntaxin_2 54..153 CDD:291208 25/115 (22%)
SNARE_syntaxin7_like 190..249 CDD:277200 20/58 (34%)
stx16XP_031750392.1 COG5325 71..299 CDD:227635 58/247 (23%)
SNARE_syntaxin16 231..289 CDD:277198 20/57 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.