DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx13 and Stx12

DIOPT Version :9

Sequence 1:NP_001261794.1 Gene:Syx13 / 39485 FlyBaseID:FBgn0036341 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_598648.1 Gene:Stx12 / 100226 MGIID:1931027 Length:274 Species:Mus musculus


Alignment Length:260 Identity:77/260 - (29%)
Similarity:144/260 - (55%) Gaps:17/260 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GSSGFSPTEFMSLSEDIGHNITAIHSSTKQLEKQLKLIGTSKEQPNLREKVHTINTKCNARVQTT 102
            |.||..|.:|.|:.:....||..|..:|.|::..:..:||.::...|:|.:..:....|...:.|
Mouse    13 GPSGPQPRDFNSIIQTCSGNIQRISQATAQIKNLMSQLGTKQDSSKLQENLQQLQHSTNQLAKET 77

  Fly   103 SQDLQRLQA----VVRHGDRQQKLQLEKLTREFHGVVEKYSNLQRRISSAMRQTLQQA------- 156
            ::.|:.|.:    :.....||||||.|:|..:|...:..:..:||::|...::::.:|       
Mouse    78 NELLKELGSLPLPLSASEQRQQKLQKERLMNDFSSALNNFQVVQRKVSEKEKESIARARAGSRLS 142

  Fly   157 ---QQFADQVVETNARAE--LLQQQRLEQAHLQQEHDMLDDRRRQVEQIESDIIDVNQIMTQLSG 216
               :|..:|:|..::..|  .:|.|..|.|..:|:.:::.:|...:.|:|:||:|||||...|:.
Mouse   143 AEDRQREEQLVSFDSHEEWNQMQSQEEEAAITEQDLELIKERETAIRQLEADILDVNQIFKDLAM 207

  Fly   217 LVHDQGQQMDFIENSIEQTAANVEDGTSELAKAARSRQSYRRKILIL-LVIAVIIGLIVTGVIVA 280
            ::||||..:|.||.::|.:..:||..|.:|.:||..::..|:|:.|| ||::||:.::|..:.||
Mouse   208 MIHDQGDLIDSIEANVESSEVHVERATDQLQRAAYYQKKSRKKMCILVLVLSVIVTVLVVVIWVA 272

  Fly   281  280
            Mouse   273  272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx13NP_001261794.1 Syntaxin_2 54..153 CDD:291208 25/102 (25%)
SNARE_syntaxin7_like 190..249 CDD:277200 23/58 (40%)
Stx12NP_598648.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 3/6 (50%)
SynN 21..164 CDD:238105 32/142 (23%)
Syntaxin 26..213 CDD:279182 48/186 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..147 1/18 (6%)
SNARE_syntaxin12 181..247 CDD:277229 25/65 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53539
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000747
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.