DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx13 and tsnare1

DIOPT Version :9

Sequence 1:NP_001261794.1 Gene:Syx13 / 39485 FlyBaseID:FBgn0036341 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001106394.1 Gene:tsnare1 / 100127544 XenbaseID:XB-GENE-5872660 Length:288 Species:Xenopus tropicalis


Alignment Length:284 Identity:80/284 - (28%)
Similarity:145/284 - (51%) Gaps:38/284 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 YGAMADSTPEVSFAAAGGSSGFSPTEFMSLSEDIGHN------------ITAIHSSTKQLEKQLK 73
            ||::..|    .|.:....||.|...:..|:..|..|            |..|:.:.:.||:.|:
 Frog     3 YGSLDGS----GFGSRNPFSGPSTQGYQPLATQIDQNELQELFQITSGDIYRININVQSLERILR 63

  Fly    74 LIGTSKEQPNLREKVHTINTKCNARVQTTSQDLQRLQAVVRHGDRQQKLQLEKLTREFHGVVEKY 138
            .:||:.:...||:::|....:.|..:.::::.:::|...||...||.:|||::|..:...::::|
 Frog    64 SLGTASDTQELRDRLHFTQQETNNTITSSTKSIRQLSEFVRGSSRQDRLQLDRLRSQLSDIIQRY 128

  Fly   139 SNLQRRISSAMRQTLQQAQQ-----------FADQVVETNARAELLQQQRLEQAHLQQEHDMLDD 192
            ..:|::|:...:..|...|:           .||.....|...|..|.|:..|...:...:.||:
 Frog   129 GVVQKKIAEKSKSLLSADQKSIKSPRTPFSDIADDENIFNGGDEQWQSQKQTQDLTEFSEEDLDE 193

  Fly   193 RRRQ---VEQIESDIIDVNQIMTQLSGLVHDQGQQMDFIENSIEQTAANVEDGTSELAKAARSRQ 254
            .|::   :.|||||::||||||..|:.:|::||..:|.||.:||..:::||....:||||::.::
 Frog   194 IRQKEEAINQIESDMLDVNQIMKDLASIVYEQGDTIDSIEANIETASSHVESANRQLAKASQHQR 258

  Fly   255 SYRR--------KILILLVIAVII 270
            ..|:        .:|:||||.|||
 Frog   259 RARKLKCCLISAGLLVLLVIVVII 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx13NP_001261794.1 Syntaxin_2 54..153 CDD:291208 25/110 (23%)
SNARE_syntaxin7_like 190..249 CDD:277200 27/61 (44%)
tsnare1NP_001106394.1 Syntaxin_2 44..141 CDD:373109 23/96 (24%)
SNARE_TSNARE1 191..254 CDD:277230 28/62 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10932
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H77339
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1204812at2759
OrthoFinder 1 1.000 - - FOG0000747
OrthoInspector 1 1.000 - - oto103681
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.010

Return to query results.
Submit another query.