DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS4 and AT5G58420

DIOPT Version :9

Sequence 1:NP_001287055.1 Gene:RpS4 / 39484 FlyBaseID:FBgn0011284 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_200650.1 Gene:AT5G58420 / 835955 AraportID:AT5G58420 Length:262 Species:Arabidopsis thaliana


Alignment Length:259 Identity:171/259 - (66%)
Similarity:212/259 - (81%) Gaps:0/259 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARGPKKHLKRLAAPKAWMLDKLGGVFAPRPSTGPHKLRESLPLLIFLRNRLKYALNGAEVTKIV 65
            ||||.|||||||.|||.||||||||.|||:||:||||.||.|||::.:||||||||...||..|:
plant     1 MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISIL 65

  Fly    66 MQRLVKVDGKVRTDPTYPAGYMDVITLEKTGEFFRLVYDVKGRFVIHRISAEEAKYKLCKVKKTQ 130
            |||.::||||||||.|||||:|||:::.||.|.|||:||.||||.:|.|..||||:|||||:..|
plant    66 MQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAKFKLCKVRSIQ 130

  Fly   131 LGAKGVPFLVTHDGRTIRYPDPLIHANDSVQVDIASGKITDYIKFDSGNLCMITGGRNLGRVGTV 195
            .|.||:|:|.|:||||||||||||..||::::|:.:.||.::||||.||:.|:|||||.||||.:
plant   131 FGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNVVMVTGGRNRGRVGVI 195

  Fly   196 VNRERHPGSFDIVHIKDSQGHVFATRLTNVFIIGKGNKPYISLPKGKGVKLSIAEERDKRLAAK 259
            .|||:|.|||:.:||:||.||.|||||.||:.||||.||::|||||||:||:|.||..||||::
plant   196 KNREKHKGSFETIHIQDSTGHEFATRLGNVYTIGKGTKPWVSLPKGKGIKLTIIEEARKRLASQ 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS4NP_001287055.1 PLN00036 1..258 CDD:177670 170/256 (66%)
AT5G58420NP_200650.1 PLN00036 1..261 CDD:177670 171/259 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 104 1.000 Domainoid score I2225
eggNOG 1 0.900 - - E1_COG1471
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H90857
Inparanoid 1 1.050 366 1.000 Inparanoid score I575
OMA 1 1.010 - - QHG62198
OrthoDB 1 1.010 - - D1065966at2759
OrthoFinder 1 1.000 - - FOG0001491
OrthoInspector 1 1.000 - - otm2532
orthoMCL 1 0.900 - - OOG6_100732
Panther 1 1.100 - - O PTHR11581
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X948
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.