DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS4 and RPS4Y1

DIOPT Version :9

Sequence 1:NP_001287055.1 Gene:RpS4 / 39484 FlyBaseID:FBgn0011284 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_000999.1 Gene:RPS4Y1 / 6192 HGNCID:10425 Length:263 Species:Homo sapiens


Alignment Length:259 Identity:192/259 - (74%)
Similarity:228/259 - (88%) Gaps:0/259 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARGPKKHLKRLAAPKAWMLDKLGGVFAPRPSTGPHKLRESLPLLIFLRNRLKYALNGAEVTKIV 65
            |||||||||||:||||.||||||.||||||||||||||||.|||::||||||||||.|.||.||.
Human     1 MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDEVKKIC 65

  Fly    66 MQRLVKVDGKVRTDPTYPAGYMDVITLEKTGEFFRLVYDVKGRFVIHRISAEEAKYKLCKVKKTQ 130
            |||.:|:|||||.|.|||||:||||::|||||.||||||.||||.:|||:.||||||||||:|..
Human    66 MQRFIKIDGKVRVDVTYPAGFMDVISIEKTGEHFRLVYDTKGRFAVHRITVEEAKYKLCKVRKIT 130

  Fly   131 LGAKGVPFLVTHDGRTIRYPDPLIHANDSVQVDIASGKITDYIKFDSGNLCMITGGRNLGRVGTV 195
            :|.||:|.|||||.||||||||:|..||:||:|:.:|||.::||||:|||||:.||.||||||.:
Human   131 VGVKGIPHLVTHDARTIRYPDPVIKVNDTVQIDLGTGKIINFIKFDTGNLCMVIGGANLGRVGVI 195

  Fly   196 VNRERHPGSFDIVHIKDSQGHVFATRLTNVFIIGKGNKPYISLPKGKGVKLSIAEERDKRLAAK 259
            .||||||||||:||:||:.|:.|||||:|:|:||.||||:||||:|||::|::|||||||||.|
Human   196 TNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGNGNKPWISLPRGKGIRLTVAEERDKRLATK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS4NP_001287055.1 PLN00036 1..258 CDD:177670 190/256 (74%)
RPS4Y1NP_000999.1 PLN00036 1..260 CDD:177670 192/259 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143158
Domainoid 1 1.000 121 1.000 Domainoid score I5688
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 430 1.000 Inparanoid score I1730
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62198
OrthoDB 1 1.010 - - D1065966at2759
OrthoFinder 1 1.000 - - FOG0001491
OrthoInspector 1 1.000 - - otm40879
orthoMCL 1 0.900 - - OOG6_100732
Panther 1 1.100 - - O PTHR11581
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X948
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.