DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS4 and rps403

DIOPT Version :9

Sequence 1:NP_001287055.1 Gene:RpS4 / 39484 FlyBaseID:FBgn0011284 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_594174.1 Gene:rps403 / 2543486 PomBaseID:SPAC959.07 Length:262 Species:Schizosaccharomyces pombe


Alignment Length:259 Identity:182/259 - (70%)
Similarity:221/259 - (85%) Gaps:0/259 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARGPKKHLKRLAAPKAWMLDKLGGVFAPRPSTGPHKLRESLPLLIFLRNRLKYALNGAEVTKIV 65
            |.|||||||||:|||..|:||||.|.:||:||.||||.||.|||::||||||||||||.||..|:
pombe     1 MVRGPKKHLKRVAAPHHWLLDKLSGTYAPKPSPGPHKARECLPLIVFLRNRLKYALNGREVKAIL 65

  Fly    66 MQRLVKVDGKVRTDPTYPAGYMDVITLEKTGEFFRLVYDVKGRFVIHRISAEEAKYKLCKVKKTQ 130
            ||||:|||||||||.|:|.|:||||:::||||.||||||:||||.:|||:||||||||||||:.|
pombe    66 MQRLIKVDGKVRTDSTFPTGFMDVISVDKTGEHFRLVYDIKGRFTVHRITAEEAKYKLCKVKRVQ 130

  Fly   131 LGAKGVPFLVTHDGRTIRYPDPLIHANDSVQVDIASGKITDYIKFDSGNLCMITGGRNLGRVGTV 195
            ||||||||||||||||||||||||..||::::::.:.||..:||||:....|:|||||:|||||:
pombe   131 LGAKGVPFLVTHDGRTIRYPDPLIKVNDTIKLNLETNKIESFIKFDTSAQVMVTGGRNMGRVGTI 195

  Fly   196 VNRERHPGSFDIVHIKDSQGHVFATRLTNVFIIGKGNKPYISLPKGKGVKLSIAEERDKRLAAK 259
            |:||.|.|||:|:|:||:....|||||:|||:||:..|.:|||||||||||||.||||:|.|.|
pombe   196 VHREHHLGSFEIIHVKDALDREFATRLSNVFVIGETGKSWISLPKGKGVKLSITEERDRRRALK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS4NP_001287055.1 PLN00036 1..258 CDD:177670 180/256 (70%)
rps403NP_594174.1 PLN00036 1..257 CDD:177670 180/255 (71%)
RS4NT 3..39 CDD:285333 26/35 (74%)
S4 44..112 CDD:238095 50/67 (75%)
Ribosomal_S4e 95..169 CDD:279271 55/73 (75%)
KOW_RPS4 175..229 CDD:240511 32/53 (60%)
40S_S4_C 212..259 CDD:292739 31/46 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 128 1.000 Domainoid score I1356
eggNOG 1 0.900 - - E1_COG1471
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H90857
Inparanoid 1 1.050 392 1.000 Inparanoid score I400
OMA 1 1.010 - - QHG62198
OrthoFinder 1 1.000 - - FOG0001491
OrthoInspector 1 1.000 - - otm47158
orthoMCL 1 0.900 - - OOG6_100732
Panther 1 1.100 - - O PTHR11581
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1247
SonicParanoid 1 1.000 - - X948
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.