DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS4 and Rps4x

DIOPT Version :9

Sequence 1:NP_001287055.1 Gene:RpS4 / 39484 FlyBaseID:FBgn0011284 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_033120.1 Gene:Rps4x / 20102 MGIID:98158 Length:263 Species:Mus musculus


Alignment Length:259 Identity:197/259 - (76%)
Similarity:233/259 - (89%) Gaps:0/259 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARGPKKHLKRLAAPKAWMLDKLGGVFAPRPSTGPHKLRESLPLLIFLRNRLKYALNGAEVTKIV 65
            |||||||||||:||||.||||||.||||||||||||||||.|||:|||||||||||.|.||.||.
Mouse     1 MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIIFLRNRLKYALTGDEVKKIC 65

  Fly    66 MQRLVKVDGKVRTDPTYPAGYMDVITLEKTGEFFRLVYDVKGRFVIHRISAEEAKYKLCKVKKTQ 130
            |||.:|:|||||||.|||||:||||:::||||.|||:||.||||.:|||:.||||||||||:|..
Mouse    66 MQRFIKIDGKVRTDITYPAGFMDVISIDKTGENFRLIYDTKGRFAVHRITPEEAKYKLCKVRKIF 130

  Fly   131 LGAKGVPFLVTHDGRTIRYPDPLIHANDSVQVDIASGKITDYIKFDSGNLCMITGGRNLGRVGTV 195
            :|.||:|.|||||.||||||||||..||::|:|:.:|||||:||||:|||||:|||.||||:|.:
Mouse   131 VGTKGIPHLVTHDARTIRYPDPLIKVNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLGRIGVI 195

  Fly   196 VNRERHPGSFDIVHIKDSQGHVFATRLTNVFIIGKGNKPYISLPKGKGVKLSIAEERDKRLAAK 259
            .||||||||||:||:||:.|:.|||||:|:|:|||||||:||||:|||::|:||||||||||||
Mouse   196 TNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGKGNKPWISLPRGKGIRLTIAEERDKRLAAK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS4NP_001287055.1 PLN00036 1..258 CDD:177670 194/256 (76%)
Rps4xNP_033120.1 PLN00036 1..260 CDD:177670 197/259 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833322
Domainoid 1 1.000 119 1.000 Domainoid score I5789
eggNOG 1 0.900 - - E1_COG1471
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 430 1.000 Inparanoid score I1716
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62198
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001491
OrthoInspector 1 1.000 - - otm42952
orthoMCL 1 0.900 - - OOG6_100732
Panther 1 1.100 - - LDO PTHR11581
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1247
SonicParanoid 1 1.000 - - X948
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.