DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS4 and RPS4Y2

DIOPT Version :9

Sequence 1:NP_001287055.1 Gene:RpS4 / 39484 FlyBaseID:FBgn0011284 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001034656.1 Gene:RPS4Y2 / 140032 HGNCID:18501 Length:263 Species:Homo sapiens


Alignment Length:259 Identity:188/259 - (72%)
Similarity:225/259 - (86%) Gaps:0/259 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARGPKKHLKRLAAPKAWMLDKLGGVFAPRPSTGPHKLRESLPLLIFLRNRLKYALNGAEVTKIV 65
            |||||||||||:||||.||||||.||||||||||||||||.|||::||||||||||.|.||.||.
Human     1 MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDEVKKIC 65

  Fly    66 MQRLVKVDGKVRTDPTYPAGYMDVITLEKTGEFFRLVYDVKGRFVIHRISAEEAKYKLCKVKKTQ 130
            ||..:|:|||||.|.|||||::|||::|||||.|||||:.||.|.:|||:.||||||||||:|..
Human    66 MQHFLKIDGKVRVDITYPAGFIDVISIEKTGEHFRLVYNTKGCFAVHRITVEEAKYKLCKVRKIT 130

  Fly   131 LGAKGVPFLVTHDGRTIRYPDPLIHANDSVQVDIASGKITDYIKFDSGNLCMITGGRNLGRVGTV 195
            :|.||:|.|||||.||||||||||..||:||:|:.:||||.:||||:||:||:..|.||||||.:
Human   131 VGTKGIPHLVTHDARTIRYPDPLIKVNDTVQIDLGTGKITSFIKFDTGNVCMVIAGANLGRVGVI 195

  Fly   196 VNRERHPGSFDIVHIKDSQGHVFATRLTNVFIIGKGNKPYISLPKGKGVKLSIAEERDKRLAAK 259
            .||||||||.|:||:||:.|:.||||::|:|:||.||||:||||:|||::|:||||||||||||
Human   196 TNRERHPGSCDVVHVKDANGNSFATRISNIFVIGNGNKPWISLPRGKGIRLTIAEERDKRLAAK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS4NP_001287055.1 PLN00036 1..258 CDD:177670 185/256 (72%)
RPS4Y2NP_001034656.1 PLN00036 1..260 CDD:177670 188/259 (73%)
RS4NT 3..39 CDD:285333 32/35 (91%)
Ribosomal_S4e 95..169 CDD:279271 50/73 (68%)
KOW_RPS4 175..229 CDD:240511 33/53 (62%)
40S_S4_C 212..259 CDD:292739 32/46 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143157
Domainoid 1 1.000 121 1.000 Domainoid score I5688
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 430 1.000 Inparanoid score I1730
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62198
OrthoDB 1 1.010 - - D1065966at2759
OrthoFinder 1 1.000 - - FOG0001491
OrthoInspector 1 1.000 - - otm40879
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11581
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X948
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1111.010

Return to query results.
Submit another query.