DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srrm1 and SPCC825.05c

DIOPT Version :9

Sequence 1:NP_648627.1 Gene:Srrm1 / 39483 FlyBaseID:FBgn0036340 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_588055.1 Gene:SPCC825.05c / 2539459 PomBaseID:SPCC825.05c Length:301 Species:Schizosaccharomyces pombe


Alignment Length:366 Identity:104/366 - (28%)
Similarity:162/366 - (44%) Gaps:86/366 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FTGTNQQQDTRFSDKEKKLMKQMKFGDCLNKRVDMSKVKLDVLRPWISKKITDILHIEDDVVVEF 67
            :.|...:|:|.|:..:||||:..||....:.:|||.||.::||:|||:.::.:::..||:||:.|
pombe     5 YKGVAAEQETLFTTADKKLMRSTKFPASYDTKVDMKKVNIEVLKPWIATRLNELIGFEDEVVINF 69

  Fly    68 VYNQLEE------------EKYPCPKKMQINMTGFLNGRNARQFMGELWALLLSAQESDSGIPAE 120
            ||..|||            |....|:|:|:|:||||.. ||..|..|||:|::||.::..|||.:
pombe    70 VYGMLEEAVEASKTSDSQNESTLDPRKVQLNLTGFLES-NATAFTEELWSLIISASQNQYGIPEK 133

  Fly   121 FIQQKKDEILKREEEQRQRDRSR-SRSRSRSQRD-SSRRDRQRDRSKSKSRSRSRSMKPANNNGS 183
            ||.:||:||.|      .:||:. |:..|::..| |:||:.:|:.:...||.|:           
pombe   134 FILEKKEEISK------LKDRTEASKEESKTVTDHSNRRESRRESTYYDSRERN----------- 181

  Fly   184 VPSAAREAAANAAAKIRKRGSSSAARPGSRERRSSRRPRSRSRSRSRTAGKKTGSVEPAPAKTVN 248
                                       |.|..||: ..|.|....|.|...:.|. .|:|     
pombe   182 ---------------------------GKRTSRST-LDRKRFHDASDTERNRYGR-SPSP----- 212

  Fly   249 GRHSTDKSSPVPPASKNKSRSRSHSRSRSPRSRSRSPSAKRSRSRSSSRRSRRRGRSSSISLSPE 313
              ||.....|.......:|.||||......|.|   |:.:|.|    ..|:|           .:
pombe   213 --HSRFSEKPRGERYDIRSYSRSHKERYEDRYR---PTRRRER----HYRTR-----------DD 257

  Fly   314 RNQDQFEHRRNKNSVQNKRQYRNNRGDSASSMERGNDRGRQ 354
            ...|:|...|:....:::..||........::...:|.|.|
pombe   258 EGFDEFGRSRDGRWRESRTSYREKHRYDRDALSSESDSGTQ 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srrm1NP_648627.1 PWI 43..113 CDD:279781 33/81 (41%)
SPCC825.05cNP_588055.1 PWI 45..126 CDD:279781 33/81 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 67 1.000 Domainoid score I2781
eggNOG 1 0.900 - - E1_KOG2146
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005511
OrthoInspector 1 1.000 - - oto101427
orthoMCL 1 0.900 - - OOG6_103077
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1912
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.740

Return to query results.
Submit another query.