DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zmynd10 and RAF2

DIOPT Version :10

Sequence 1:NP_648625.1 Gene:Zmynd10 / 39481 FlyBaseID:FBgn0266709 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_648889.2 Gene:RAF2 / 39821 FlyBaseID:FBgn0036624 Length:1117 Species:Drosophila melanogaster


Alignment Length:51 Identity:19/51 - (37%)
Similarity:27/51 - (52%) Gaps:1/51 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   399 DAGAGGDGDTDHTCATCQA-KAKKKCACCKKVHYCSRDCQLKDWPQHKLVC 448
            ::.|..:|:|...|..|:. .|...|:.|:...||||:|||.||..|...|
  Fly  1065 ESSATINGNTGRQCHECKLYGATFMCSNCQNQWYCSRECQLSDWDTHHRTC 1115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zmynd10NP_648625.1 zf-MYND <429..448 CDD:460312 10/18 (56%)
RAF2NP_648889.2 PAT1 367..>533 CDD:401645
zf-MYND 1078..1115 CDD:460312 15/36 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.