DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS12 and RPS12

DIOPT Version :9

Sequence 1:NP_729866.1 Gene:RpS12 / 39480 FlyBaseID:FBgn0286213 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_015014.3 Gene:RPS12 / 854551 SGDID:S000005896 Length:143 Species:Saccharomyces cerevisiae


Alignment Length:142 Identity:63/142 - (44%)
Similarity:91/142 - (64%) Gaps:5/142 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADVD--VDVPSAAPVLDGA-MDINTALQEVLKKSLIADGLVHGIHQACKALDKRQAVLCILAES 62
            |:||:  |:|.....|...| :.|..||:.||:.:|:.|||..|:.::.|||.:.:|:|.:|..|
Yeast     1 MSDVEEVVEVQEETVVEQTAEVTIEDALKVVLRTALVHDGLARGLRESTKALTRGEALLVVLVSS 65

  Fly    63 FDEPNYKKLVTALCN--EHQIPLIRVDSHKKLGEWSGLCKIDKEGKPRKVCGCSVVVIKDFGEET 125
            ..|.|..|||..|.|  |:::|||:|...|:||||:||.|||:||..|||.|.||||:|::|.||
Yeast    66 VTEANIIKLVEGLANDPENKVPLIKVADAKQLGEWAGLGKIDREGNARKVVGASVVVVKNWGAET 130

  Fly   126 PALDVVKDHLRQ 137
            ..|.::.:|..|
Yeast   131 DELSMIMEHFSQ 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS12NP_729866.1 Ribosomal_L7Ae 23..118 CDD:396000 47/96 (49%)
RPS12NP_015014.3 Ribosomal_L7Ae 26..114 CDD:396000 40/87 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346232
Domainoid 1 1.000 91 1.000 Domainoid score I1754
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I1392
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54130
OrthoFinder 1 1.000 - - FOG0001708
OrthoInspector 1 1.000 - - oto99962
orthoMCL 1 0.900 - - OOG6_101261
Panther 1 1.100 - - LDO PTHR11843
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1230
SonicParanoid 1 1.000 - - X1102
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.