DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS12 and AT1G15930

DIOPT Version :9

Sequence 1:NP_729866.1 Gene:RpS12 / 39480 FlyBaseID:FBgn0286213 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_173045.1 Gene:AT1G15930 / 838163 AraportID:AT1G15930 Length:144 Species:Arabidopsis thaliana


Alignment Length:135 Identity:68/135 - (50%)
Similarity:91/135 - (67%) Gaps:1/135 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ADVDVDVPSAAP-VLDGAMDINTALQEVLKKSLIADGLVHGIHQACKALDKRQAVLCILAESFDE 65
            |.|.|..|.|.| .:...||:.|||:..|:|:....|:|.|:|:..|.::||.|.|.:|||..::
plant     7 APVVVPPPVAEPAAIPEDMDLMTALELTLRKARAYGGVVRGLHECAKLIEKRVAQLVVLAEDCNQ 71

  Fly    66 PNYKKLVTALCNEHQIPLIRVDSHKKLGEWSGLCKIDKEGKPRKVCGCSVVVIKDFGEETPALDV 130
            |:|.|||.|||.:|::.|:.|.|.|.||||:||||||.||..|||.|||.:|:|||||||.||.:
plant    72 PDYVKLVKALCADHEVRLLTVPSAKTLGEWAGLCKIDSEGNARKVVGCSCLVVKDFGEETTALSI 136

  Fly   131 VKDHL 135
            |..|:
plant   137 VNKHI 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS12NP_729866.1 Ribosomal_L7Ae 23..118 CDD:396000 48/94 (51%)
AT1G15930NP_173045.1 Ribosomal_L7Ae 29..124 CDD:396000 48/94 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 108 1.000 Domainoid score I2155
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 148 1.000 Inparanoid score I1730
OMA 1 1.010 - - QHG54130
OrthoDB 1 1.010 - - D1474866at2759
OrthoFinder 1 1.000 - - FOG0001708
OrthoInspector 1 1.000 - - otm3116
orthoMCL 1 0.900 - - OOG6_101261
Panther 1 1.100 - - LDO PTHR11843
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1102
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.