DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS12 and AT5G08180

DIOPT Version :9

Sequence 1:NP_729866.1 Gene:RpS12 / 39480 FlyBaseID:FBgn0286213 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001190260.1 Gene:AT5G08180 / 830714 AraportID:AT5G08180 Length:156 Species:Arabidopsis thaliana


Alignment Length:124 Identity:28/124 - (22%)
Similarity:56/124 - (45%) Gaps:11/124 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PSAAPVLDGAMDINTALQEVLKKSLIADGLVHGIHQACKALDKRQAVLCILAESFDEPNYKKLVT 73
            |.|.|:....:...|.  ::::|:.....|..|:.:..|::.:.|..||::|.:....:....:.
plant    24 PIAKPLAGKKLQKRTF--KLIQKAAGKKCLKRGVKEVVKSIRRGQKGLCVIAGNISPIDVITHLP 86

  Fly    74 ALCNEHQIPLIRVDSHKKLGEWSGLCKIDKEGKPRKVCGCSVVVIKDFGEETPALDVVK 132
            .||.|..:|.:.|.|.:.|.: :|..|       |..| |.:|::|....:..|.::.|
plant    87 ILCEEAGVPYVYVPSKEDLAQ-AGATK-------RPTC-CVLVMLKPAKGDLTAEELAK 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS12NP_729866.1 Ribosomal_L7Ae 23..118 CDD:396000 22/94 (23%)
AT5G08180NP_001190260.1 SNU13 24..151 CDD:411046 28/124 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.