powered by:
Protein Alignment RpS12 and AT3G62870
DIOPT Version :9
Sequence 1: | NP_729866.1 |
Gene: | RpS12 / 39480 |
FlyBaseID: | FBgn0286213 |
Length: | 139 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_191846.1 |
Gene: | AT3G62870 / 825462 |
AraportID: | AT3G62870 |
Length: | 256 |
Species: | Arabidopsis thaliana |
Alignment Length: | 64 |
Identity: | 14/64 - (21%) |
Similarity: | 31/64 - (48%) |
Gaps: | 3/64 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 30 KKSLIADGLVHGIHQACKALDKRQAVLCILAESFDEPNYKKLVTALCNEHQIPLIRVDSHKKLG 93
||.:: :.:|::.....:::.:|.|.::|...|.......:.|||.:.::|...|....:||
plant 121 KKPIV---VKYGLNHVTYLIEQNKAQLVVIAHDVDPIELVVWLPALCRKMEVPYCIVKGKSRLG 181
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1358 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.