DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS12 and AT2G32060

DIOPT Version :9

Sequence 1:NP_729866.1 Gene:RpS12 / 39480 FlyBaseID:FBgn0286213 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001318332.1 Gene:AT2G32060 / 817766 AraportID:AT2G32060 Length:144 Species:Arabidopsis thaliana


Alignment Length:141 Identity:74/141 - (52%)
Similarity:96/141 - (68%) Gaps:5/141 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DVDVDVPSAAPVLDGA-----MDINTALQEVLKKSLIADGLVHGIHQACKALDKRQAVLCILAES 62
            |..|..|...||.:.|     ||::|||:..::||....|:|.|:|::.|.::||.|.||:|||.
plant     4 DEAVAAPVVPPVAEAAVIPEDMDVSTALELTVRKSRAYGGVVRGLHESAKLIEKRNAQLCVLAED 68

  Fly    63 FDEPNYKKLVTALCNEHQIPLIRVDSHKKLGEWSGLCKIDKEGKPRKVCGCSVVVIKDFGEETPA 127
            .::|:|.|||.|||.:|.|.|:.|.|.|.||||:||||||.||..|||.|||.:|||||||||.|
plant    69 CNQPDYVKLVKALCADHSIKLLTVPSAKTLGEWAGLCKIDSEGNARKVVGCSCLVIKDFGEETTA 133

  Fly   128 LDVVKDHLRQN 138
            |::||.||..|
plant   134 LNIVKKHLDSN 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS12NP_729866.1 Ribosomal_L7Ae 23..118 CDD:396000 50/94 (53%)
AT2G32060NP_001318332.1 Ribosomal_L7Ae 29..124 CDD:396000 50/94 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 108 1.000 Domainoid score I2155
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 148 1.000 Inparanoid score I1730
OMA 1 1.010 - - QHG54130
OrthoDB 1 1.010 - - D1474866at2759
OrthoFinder 1 1.000 - - FOG0001708
OrthoInspector 1 1.000 - - otm3116
orthoMCL 1 0.900 - - OOG6_101261
Panther 1 1.100 - - O PTHR11843
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1102
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.