powered by:
Protein Alignment RpS12 and Rsrc1
DIOPT Version :9
Sequence 1: | NP_729866.1 |
Gene: | RpS12 / 39480 |
FlyBaseID: | FBgn0286213 |
Length: | 139 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001343202.1 |
Gene: | Rsrc1 / 66880 |
MGIID: | 1914130 |
Length: | 338 |
Species: | Mus musculus |
Alignment Length: | 74 |
Identity: | 19/74 - (25%) |
Similarity: | 29/74 - (39%) |
Gaps: | 11/74 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 LDGAMDINTALQEVLKKSLIADGLVHGIHQACKALDKRQAVLCILAESFDEPNYKKLVTALCNEH 79
|..|......||.||:.:..|| :|.||.::.:.. |:...|.:...||..:....
Mouse 181 LPPAEQAKARLQLVLEAAAKAD-------EALKAKERSEEE----AKRRKEEDQATLVEQVKRVK 234
Fly 80 QIPLIRVDS 88
:|..|..||
Mouse 235 EIEAIESDS 243
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
RpS12 | NP_729866.1 |
Ribosomal_L7Ae |
23..118 |
CDD:396000 |
17/66 (26%) |
Rsrc1 | NP_001343202.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1358 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.