DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS12 and rps12

DIOPT Version :9

Sequence 1:NP_729866.1 Gene:RpS12 / 39480 FlyBaseID:FBgn0286213 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001008435.1 Gene:rps12 / 493270 XenbaseID:XB-GENE-972800 Length:132 Species:Xenopus tropicalis


Alignment Length:120 Identity:81/120 - (67%)
Similarity:98/120 - (81%) Gaps:0/120 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GAMDINTALQEVLKKSLIADGLVHGIHQACKALDKRQAVLCILAESFDEPNYKKLVTALCNEHQI 81
            |.||:|||||||||.:||.|||..||.:|.||||||||.||:||.:.|||.|.|||.|||.||||
 Frog    10 GVMDVNTALQEVLKTALIHDGLARGIREAAKALDKRQAHLCVLASNCDEPMYVKLVEALCAEHQI 74

  Fly    82 PLIRVDSHKKLGEWSGLCKIDKEGKPRKVCGCSVVVIKDFGEETPALDVVKDHLR 136
            .||:||.:||||||.||||||:|||||||.|||.||:||:|:|:.|.||::::.:
 Frog    75 NLIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVVKDYGKESQAKDVIEEYFK 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS12NP_729866.1 Ribosomal_L7Ae 23..118 CDD:396000 69/94 (73%)
rps12NP_001008435.1 Ribosomal_L7Ae 16..111 CDD:366537 69/94 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 139 1.000 Domainoid score I4778
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I4010
OMA 1 1.010 - - QHG54130
OrthoDB 1 1.010 - - D1474866at2759
OrthoFinder 1 1.000 - - FOG0001708
OrthoInspector 1 1.000 - - oto104577
Panther 1 1.100 - - LDO PTHR11843
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1102
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.080

Return to query results.
Submit another query.