DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS12 and gadd45g

DIOPT Version :9

Sequence 1:NP_729866.1 Gene:RpS12 / 39480 FlyBaseID:FBgn0286213 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001004986.1 Gene:gadd45g / 448442 XenbaseID:XB-GENE-481955 Length:159 Species:Xenopus tropicalis


Alignment Length:138 Identity:35/138 - (25%)
Similarity:69/138 - (50%) Gaps:21/138 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DVPSAAPVLDGAMDINT---ALQEVLKKSLIADGLVHGIHQACKAL--DKRQAVLCIL-AESFDE 65
            :|.....|::.|..:.|   ||.|:|..:...:.|..|::::.|.:  |......||| |:.:||
 Frog     5 EVHGQETVVESADRMQTAGKALHELLVSAQREECLTVGVYESAKVMNVDPDSVTFCILAADEYDE 69

  Fly    66 PN-----YKKLVTALCNEHQIPLIRVDSHKKLGEWSGLCKIDKEGKPRKV-CGCSVVVIKDFGEE 124
            .:     :..|:.|.|.|:.|.::|::..:|:.:..||  .|:..:|:.: |    ::|.:..|:
 Frog    70 GDIALQIHFTLIQAFCCENDINIVRLNDTEKVAQILGL--TDESAEPKDLHC----ILITNPNED 128

  Fly   125 T---PALD 129
            .   |||:
 Frog   129 AWKDPALE 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS12NP_729866.1 Ribosomal_L7Ae 23..118 CDD:396000 27/106 (25%)
gadd45gNP_001004986.1 Ribosomal_L7Ae 24..>107 CDD:321063 21/82 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.