powered by:
Protein Alignment RpS12 and rpp38
DIOPT Version :9
Sequence 1: | NP_729866.1 |
Gene: | RpS12 / 39480 |
FlyBaseID: | FBgn0286213 |
Length: | 139 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001002525.2 |
Gene: | rpp38 / 436798 |
ZFINID: | ZDB-GENE-040718-258 |
Length: | 265 |
Species: | Danio rerio |
Alignment Length: | 78 |
Identity: | 17/78 - (21%) |
Similarity: | 25/78 - (32%) |
Gaps: | 29/78 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 38 LVHGIHQACKALDKRQAVLCILAESFDEPNYKKLVTALCNEHQIPLIRVDSHKKLGEWSGLCKID 102
|..||::..|.|::.:..|.::..| :..|....|.|||
Zfish 110 LAIGINEVTKGLERNELSLVLVCNS--------VTPAHMTSHLIPL------------------- 147
Fly 103 KEGKPRKVCGCSV 115
.|.|.|..|.|
Zfish 148 --SKTRSVPACQV 158
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1358 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.