DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS12 and gadd45ab

DIOPT Version :9

Sequence 1:NP_729866.1 Gene:RpS12 / 39480 FlyBaseID:FBgn0286213 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001002216.1 Gene:gadd45ab / 431763 ZFINID:ZDB-GENE-040704-60 Length:156 Species:Danio rerio


Alignment Length:96 Identity:33/96 - (34%)
Similarity:51/96 - (53%) Gaps:16/96 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PVLDGA---MD-INTALQEVLKKSLIADGLVHGIHQACKAL--DKRQAVLCILAESFDEPNYK-- 69
            |..|.|   || :..||:|||..:|....:..|:::|.|:|  |....|||:||.  ||.:.|  
Zfish     6 PCGDNATERMDSVEKALEEVLTAALPQGCITVGVYEAAKSLNVDPDNVVLCLLAT--DEEDVKDV 68

  Fly    70 ------KLVTALCNEHQIPLIRVDSHKKLGE 94
                  .|:.|.|.|:.|.::||::.::|.|
Zfish    69 ALQIHFTLIQAFCCENDINILRVNNMRRLAE 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS12NP_729866.1 Ribosomal_L7Ae 23..118 CDD:396000 28/82 (34%)
gadd45abNP_001002216.1 Ribosomal_L7Ae 20..>101 CDD:279573 28/82 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.