DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS12 and snu13

DIOPT Version :9

Sequence 1:NP_729866.1 Gene:RpS12 / 39480 FlyBaseID:FBgn0286213 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_988994.1 Gene:snu13 / 394590 XenbaseID:XB-GENE-963821 Length:128 Species:Xenopus tropicalis


Alignment Length:137 Identity:29/137 - (21%)
Similarity:61/137 - (44%) Gaps:12/137 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADVDVDVPSAAPVLDGAMDINTALQEVLKKSLIADGLVHGIHQACKALDKRQAVLCILAESFDE 65
            |.:.:|: |.|.|:.|.  .:...|.::::::.....|..|.::|.|.|::..|...::|...:.
 Frog     1 MTEPEVN-PKAYPLADA--QLTKTLLDLVQQAANYKQLRKGANEATKTLNRGIAEFIVMAADAEP 62

  Fly    66 PNYKKLVTALCNEHQIPLIRVDSHKKLGEWSGLCKIDKEGKPRKVCGCSVVVIKDFGEETPALDV 130
            ......:..||.:..:|.:.|.|.:.||...|:        .|.|..|: |.||:..:..|.:..
 Frog    63 LEIILHLPLLCEDKNVPYVFVRSKQALGRACGV--------SRPVIACA-VTIKEGSQLKPQIQS 118

  Fly   131 VKDHLRQ 137
            ::..:.:
 Frog   119 LQQSIER 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS12NP_729866.1 Ribosomal_L7Ae 23..118 CDD:396000 20/94 (21%)
snu13NP_988994.1 Rpl7Ae 9..103 CDD:224277 21/103 (20%)
Interaction with U4 snRNA and U4atac snRNA. /evidence=ECO:0000250|UniProtKB:P55769 36..48 4/11 (36%)
Important for U4 snRNA-binding. /evidence=ECO:0000250|UniProtKB:P55769 96..128 7/31 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.