DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS12 and rps12

DIOPT Version :9

Sequence 1:NP_729866.1 Gene:RpS12 / 39480 FlyBaseID:FBgn0286213 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001269106.1 Gene:rps12 / 337007 ZFINID:ZDB-GENE-030131-8951 Length:132 Species:Danio rerio


Alignment Length:120 Identity:81/120 - (67%)
Similarity:97/120 - (80%) Gaps:0/120 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GAMDINTALQEVLKKSLIADGLVHGIHQACKALDKRQAVLCILAESFDEPNYKKLVTALCNEHQI 81
            |.||:||||.||||.:||.|||..||.:|.||||||||.||:||.:.|||.|.|||.|||.||||
Zfish    10 GVMDVNTALPEVLKTALIHDGLARGIREAAKALDKRQAHLCVLAANCDEPMYVKLVEALCAEHQI 74

  Fly    82 PLIRVDSHKKLGEWSGLCKIDKEGKPRKVCGCSVVVIKDFGEETPALDVVKDHLR 136
            .||:||.:||||||.||||||:|||||||.|||.|||||:|:|:.|.||::::.:
Zfish    75 NLIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVIKDYGKESQAKDVIEEYFK 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS12NP_729866.1 Ribosomal_L7Ae 23..118 CDD:396000 68/94 (72%)
rps12NP_001269106.1 Ribosomal_L7Ae 16..111 CDD:396000 68/94 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595145
Domainoid 1 1.000 136 1.000 Domainoid score I4898
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 168 1.000 Inparanoid score I4136
OMA 1 1.010 - - QHG54130
OrthoDB 1 1.010 - - D1474866at2759
OrthoFinder 1 1.000 - - FOG0001708
OrthoInspector 1 1.000 - - oto39534
orthoMCL 1 0.900 - - OOG6_101261
Panther 1 1.100 - - LDO PTHR11843
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1230
SonicParanoid 1 1.000 - - X1102
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.