DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS12 and RGD1562265

DIOPT Version :9

Sequence 1:NP_729866.1 Gene:RpS12 / 39480 FlyBaseID:FBgn0286213 Length:139 Species:Drosophila melanogaster
Sequence 2:XP_038967469.1 Gene:RGD1562265 / 313283 RGDID:1562265 Length:132 Species:Rattus norvegicus


Alignment Length:136 Identity:77/136 - (56%)
Similarity:96/136 - (70%) Gaps:7/136 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADVDVDVPSAAPVLDGAMDINTALQEVLKKSLIADGLVHGIHQACKALDKRQAVLCILAESFDE 65
            ||:.|:       ...|.:|||||||||||.:.|.|.|..||.:|.|||||.||.||:||.:.||
  Rat     1 MAEGDI-------AAGGVIDINTALQEVLKTAFIHDALACGIREAAKALDKCQAHLCVLASNCDE 58

  Fly    66 PNYKKLVTALCNEHQIPLIRVDSHKKLGEWSGLCKIDKEGKPRKVCGCSVVVIKDFGEETPALDV 130
            |.|.|||.|||.||||.|::||.:||||||.|.||||.||||.||.|||.:|:||:|:|:...||
  Rat    59 PMYVKLVEALCAEHQINLMKVDDNKKLGEWVGPCKIDLEGKPLKVVGCSCIVVKDYGKESQDKDV 123

  Fly   131 VKDHLR 136
            :|::.:
  Rat   124 IKEYFK 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS12NP_729866.1 Ribosomal_L7Ae 23..118 CDD:396000 62/94 (66%)
RGD1562265XP_038967469.1 Ribosomal_L7Ae 16..111 CDD:396000 62/94 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353097
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11843
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.