DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS12 and Snu13

DIOPT Version :9

Sequence 1:NP_729866.1 Gene:RpS12 / 39480 FlyBaseID:FBgn0286213 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_997680.1 Gene:Snu13 / 300092 RGDID:1303103 Length:128 Species:Rattus norvegicus


Alignment Length:117 Identity:28/117 - (23%)
Similarity:52/117 - (44%) Gaps:11/117 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADVDVDVPSAAPVLDGAMDINTALQEVLKKSLIADGLVHGIHQACKALDKRQAVLCILAESFDE 65
            |.:.||: |.|.|:.|.  .:...|.:::::|.....|..|.::|.|.|::..:...::|...:.
  Rat     1 MTEADVN-PKAYPLADA--HLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEP 62

  Fly    66 PNYKKLVTALCNEHQIPLIRVDSHKKLGEWSGLCKIDKEGKPRKVCGCSVVV 117
            ......:..||.:..:|.:.|.|.:.||...|:        .|.|..|||.:
  Rat    63 LEIILHLPLLCEDKNVPYVFVRSKQALGRACGV--------SRPVIACSVTI 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS12NP_729866.1 Ribosomal_L7Ae 23..118 CDD:396000 21/95 (22%)
Snu13NP_997680.1 SNU13 7..128 CDD:411046 25/111 (23%)
Interaction with U4 snRNA and U4atac snRNA. /evidence=ECO:0000250|UniProtKB:P55769 36..48 4/11 (36%)
Important for U4 snRNA-binding. /evidence=ECO:0000250|UniProtKB:P55769 96..128 5/11 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.