DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS12 and Rpl7a

DIOPT Version :9

Sequence 1:NP_729866.1 Gene:RpS12 / 39480 FlyBaseID:FBgn0286213 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_038749.1 Gene:Rpl7a / 27176 MGIID:1353472 Length:266 Species:Mus musculus


Alignment Length:161 Identity:32/161 - (19%)
Similarity:55/161 - (34%) Gaps:41/161 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VPSAAPVLDGAMDINTALQ-------------EVLKKSLIADG-----------------LVHGI 42
            ||.|......|:|..||.|             :..|:.|:|..                 |..|:
Mouse    76 VPPAINQFTQALDRQTATQLLKLAHKYRPETKQEKKQRLLARAEKKAAGKGDVPTKRPPVLRAGV 140

  Fly    43 HQACKALDKRQAVLCILAESFDEPNYKKLVTALCNEHQIPLIRVDSHKKLGEWSGLCKIDKEGKP 107
            :.....::.::|.|.::|...|.......:.|||.:..:|...:....:||..          ..
Mouse   141 NTVTTLVENKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCIIKGKARLGHL----------VH 195

  Fly   108 RKVCGCSVVVIKDFGEETPALDVVKDHLRQN 138
            ||.| .:|...:...|:..||..:.:.:|.|
Mouse   196 RKTC-TTVAFTQVNSEDKGALAKLVEAIRTN 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS12NP_729866.1 Ribosomal_L7Ae 23..118 CDD:396000 22/124 (18%)
Rpl7aNP_038749.1 PTZ00365 16..266 CDD:240382 32/161 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.