DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS12 and nhp2

DIOPT Version :9

Sequence 1:NP_729866.1 Gene:RpS12 / 39480 FlyBaseID:FBgn0286213 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_594717.1 Gene:nhp2 / 2542369 PomBaseID:SPAC1782.10c Length:154 Species:Schizosaccharomyces pombe


Alignment Length:147 Identity:30/147 - (20%)
Similarity:61/147 - (41%) Gaps:28/147 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DVDVDVPSAAPVLD--GAMDINTALQEVLKKSLIADGLVHGIHQACKALDKRQAVLCILAESFDE 65
            :.|..:|:..|:..  ....:|..:.:.:||:.....::.|:.:..||:.|.:..|.|||.....
pombe    17 EYDSYLPALMPIAKPLAPKKLNKKMMKTVKKASKQKHILRGVKEVVKAVRKGEKGLVILAGDISP 81

  Fly    66 PNYKKLVTALCNEHQIPLIRVDSHKKLGEWSGLCKIDKEGKPRKVCGCSVVV----------IKD 120
            .:....:..||.::.:|.:...|.:.|||.|         ..::...|.::|          :::
pombe    82 MDVISHIPVLCEDNNVPYLYTVSKELLGEAS---------NTKRPTSCVMIVPGGKKKDMSKVEE 137

  Fly   121 FGE-------ETPALDV 130
            :.|       |.|||:|
pombe   138 YKESYEEIIKEVPALEV 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS12NP_729866.1 Ribosomal_L7Ae 23..118 CDD:396000 20/104 (19%)
nhp2NP_594717.1 Ribosomal_L7Ae 39..133 CDD:279573 20/102 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.