DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS12 and rps1202

DIOPT Version :9

Sequence 1:NP_729866.1 Gene:RpS12 / 39480 FlyBaseID:FBgn0286213 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_595206.1 Gene:rps1202 / 2540015 PomBaseID:SPBC1685.02c Length:148 Species:Schizosaccharomyces pombe


Alignment Length:135 Identity:63/135 - (46%)
Similarity:87/135 - (64%) Gaps:11/135 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VPSAAPVLD-----------GAMDINTALQEVLKKSLIADGLVHGIHQACKALDKRQAVLCILAE 61
            ||.|..|::           ..:.:..:|:||||::|:.|||..||.:|.||||:|||.||:|.|
pombe     8 VPQAEEVIETVEVVEEETGSSPLSVEDSLKEVLKRALVHDGLARGIREASKALDRRQAHLCVLCE 72

  Fly    62 SFDEPNYKKLVTALCNEHQIPLIRVDSHKKLGEWSGLCKIDKEGKPRKVCGCSVVVIKDFGEETP 126
            |.|:..|.|||.|||.|.|.||::|...|.||||:|||.:|::|..|||.|||.|.:.|:||::.
pombe    73 SCDQEAYVKLVEALCAESQTPLVKVADPKILGEWAGLCVLDRDGNARKVVGCSCVAVTDYGEDSV 137

  Fly   127 ALDVV 131
            ||..:
pombe   138 ALQTL 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS12NP_729866.1 Ribosomal_L7Ae 23..118 CDD:396000 54/94 (57%)
rps1202NP_595206.1 Ribosomal_L7Ae 34..129 CDD:279573 54/94 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 114 1.000 Domainoid score I1538
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I1419
OMA 1 1.010 - - QHG54130
OrthoFinder 1 1.000 - - FOG0001708
OrthoInspector 1 1.000 - - otm47331
orthoMCL 1 0.900 - - OOG6_101261
Panther 1 1.100 - - O PTHR11843
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1102
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.