DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS12 and Gm4925

DIOPT Version :9

Sequence 1:NP_729866.1 Gene:RpS12 / 39480 FlyBaseID:FBgn0286213 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001032243.1 Gene:Gm4925 / 237433 MGIID:3643371 Length:132 Species:Mus musculus


Alignment Length:127 Identity:80/127 - (62%)
Similarity:101/127 - (79%) Gaps:3/127 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SAAPVLDGAMDINTALQEVLKKSLIADGLVHGIHQACKALDKRQAVLCILAESFDEPNYKKLVTA 74
            :||.|:   ||:|||||||||.:|:.|||..|||:|.|||.||||.||:||.:.|:|.|.|||..
Mouse     6 TAAGVV---MDVNTALQEVLKTALVHDGLARGIHEAAKALGKRQAHLCVLASNCDKPMYIKLVET 67

  Fly    75 LCNEHQIPLIRVDSHKKLGEWSGLCKIDKEGKPRKVCGCSVVVIKDFGEETPALDVVKDHLR 136
            ||.||||.||:||.:||||||.||||||::||||||.|||.||:||||:|:.|.||::::.:
Mouse    68 LCAEHQINLIKVDDNKKLGEWVGLCKIDRKGKPRKVIGCSCVVVKDFGQESQAKDVIEEYFK 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS12NP_729866.1 Ribosomal_L7Ae 23..118 CDD:396000 65/94 (69%)
Gm4925NP_001032243.1 Ribosomal_L7Ae 16..111 CDD:279573 65/94 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1474866at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.