DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS12 and Y48A6B.3

DIOPT Version :9

Sequence 1:NP_729866.1 Gene:RpS12 / 39480 FlyBaseID:FBgn0286213 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_499415.1 Gene:Y48A6B.3 / 176531 WormBaseID:WBGene00012964 Length:163 Species:Caenorhabditis elegans


Alignment Length:130 Identity:31/130 - (23%)
Similarity:58/130 - (44%) Gaps:16/130 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PSAAPVLDGAMDINTALQEVLKKSLIAD-GLVHGIHQACKALDKRQAVLCILAESFDEPNYKKLV 72
            |.|.|:.:  ..:...:.:::||:...| .|..||....|.|.:.:..:||||.:....:....:
 Worm    41 PIAQPLAN--RKLAKKVYKLIKKASAGDKTLREGIKDVQKELRRNEKGICILAGNVSPIDVYSHI 103

  Fly    73 TALCNEHQIPLIRVDSHKKLGEWSGLCKIDKEGKPRKVCGCSVVV-IKDFGEETPALDVVKDHLR 136
            ..:|.|.:||.:.:.|.::||...|      ..:|      |::: :|..|:.....|.|.:.||
 Worm   104 PGICEEKEIPYVYIPSREQLGLAVG------HRRP------SILIFVKPSGDFKELYDEVAEALR 156

  Fly   137  136
             Worm   157  156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS12NP_729866.1 Ribosomal_L7Ae 23..118 CDD:396000 22/96 (23%)
Y48A6B.3NP_499415.1 Ribosomal_L7Ae 53..148 CDD:279573 24/106 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.