DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS12 and GADD45A

DIOPT Version :9

Sequence 1:NP_729866.1 Gene:RpS12 / 39480 FlyBaseID:FBgn0286213 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001915.1 Gene:GADD45A / 1647 HGNCID:4095 Length:165 Species:Homo sapiens


Alignment Length:122 Identity:35/122 - (28%)
Similarity:56/122 - (45%) Gaps:21/122 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 MD-INTALQEVLKKSLIADGLVHGIHQACKAL--DKRQAVLCILAESFDEPN------YKKLVTA 74
            || :..||:|||.|:|....:..|:::|.|.|  |....|||:||...|:..      :..|:.|
Human    16 MDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQA 80

  Fly    75 LCNEHQIPLIRVDSHKKLGEWSGLCKIDKEGKPRKVCGCSVVVIKDFGEETPALDVV 131
            .|.|:.|.::||.:..:|.|   |..::.:..|         ...:..|:.|.|..|
Human    81 FCCENDINILRVSNPGRLAE---LLLLETDAGP---------AASEGAEQPPDLHCV 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS12NP_729866.1 Ribosomal_L7Ae 23..118 CDD:396000 29/102 (28%)
GADD45ANP_001915.1 Ribosomal_L7Ae 21..123 CDD:396000 31/113 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.