DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS12 and RL7A_ANOGA

DIOPT Version :9

Sequence 1:NP_729866.1 Gene:RpS12 / 39480 FlyBaseID:FBgn0286213 Length:139 Species:Drosophila melanogaster
Sequence 2:XP_316000.1 Gene:RL7A_ANOGA / 1276631 VectorBaseID:AGAP005960 Length:271 Species:Anopheles gambiae


Alignment Length:104 Identity:24/104 - (23%)
Similarity:44/104 - (42%) Gaps:11/104 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 ADGLVHGIHQACKALDKRQAVLCILAESFDEPNYKKLVTALCNEHQIPLIRVDSHKKLGEWSGLC 99
            |:.|..||:...|.:::::|.|.|:|...|.......:.|||.:..:|...:....:||..    
Mosquito   139 ANQLRQGINSVVKMVEQKKAQLVIIAHDVDPIELVVYLPALCRKMGVPYCIIKGKARLGTL---- 199

  Fly   100 KIDKEGKPRKVCGCSVVVIKDFGEETPALDVVKDHLRQN 138
                  ..||.|.| |.:.:....:.|.|..:.:.::.|
Mosquito   200 ------VYRKTCTC-VALTQVENADKPNLAKLVETIKTN 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS12NP_729866.1 Ribosomal_L7Ae 23..118 CDD:396000 21/82 (26%)
RL7A_ANOGAXP_316000.1 PTZ00365 18..270 CDD:240382 24/104 (23%)
Ribosomal_L7Ae 38..258 CDD:294400 24/104 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.