DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS12 and AgaP_AGAP011077

DIOPT Version :9

Sequence 1:NP_729866.1 Gene:RpS12 / 39480 FlyBaseID:FBgn0286213 Length:139 Species:Drosophila melanogaster
Sequence 2:XP_309573.2 Gene:AgaP_AGAP011077 / 1270851 VectorBaseID:AGAP011077 Length:137 Species:Anopheles gambiae


Alignment Length:139 Identity:118/139 - (84%)
Similarity:131/139 - (94%) Gaps:2/139 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADVDVDVPSAAPVLDGAMDINTALQEVLKKSLIADGLVHGIHQACKALDKRQAVLCILAESFDE 65
            |:||:|:.|| ||| ||:||:||||||||||||||||||||||:||||||||||||||||||.||
Mosquito     1 MSDVEVEAPS-APV-DGSMDVNTALQEVLKKSLIADGLVHGIHEACKALDKRQAVLCILAESCDE 63

  Fly    66 PNYKKLVTALCNEHQIPLIRVDSHKKLGEWSGLCKIDKEGKPRKVCGCSVVVIKDFGEETPALDV 130
            |.||||:||||||||||||||||:||||||||||||||||||||:||.|.||:||||||||||||
Mosquito    64 PQYKKLITALCNEHQIPLIRVDSNKKLGEWSGLCKIDKEGKPRKICGASCVVLKDFGEETPALDV 128

  Fly   131 VKDHLRQNS 139
            :|:||||.:
Mosquito   129 IKEHLRQTA 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS12NP_729866.1 Ribosomal_L7Ae 23..118 CDD:396000 86/94 (91%)
AgaP_AGAP011077XP_309573.2 Ribosomal_L7Ae 21..115 CDD:279573 85/93 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 180 1.000 Domainoid score I7280
eggNOG 1 0.900 - - E1_COG1358
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H138366
Inparanoid 1 1.050 242 1.000 Inparanoid score I5682
OMA 1 1.010 - - QHG54130
OrthoDB 1 1.010 - - D1474866at2759
OrthoFinder 1 1.000 - - FOG0001708
OrthoInspector 1 1.000 - - oto109831
Panther 1 1.100 - - LDO PTHR11843
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1102
TreeFam 1 0.960 - -
1312.940

Return to query results.
Submit another query.